BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30651 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.9 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 25 2.9 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 24 3.8 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 5.0 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 5.0 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 8.8 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.9 Identities = 18/72 (25%), Positives = 33/72 (45%) Frame = -2 Query: 436 VSYCHNFLIESNYCVPEQLTPNHRALNSPVELVQGTFPSIRPQACPLSIPLFLVSALRGR 257 V+Y ++ +E +PE+ R + +P E QG F + + P I F + G Sbjct: 851 VAYLYHIRMELICPIPEEQNTRGRKIYAPEESAQG-FGILTTKLIP-KISSFPIFTRSGE 908 Query: 256 HKVTLHILRNQI 221 KV+L + ++ Sbjct: 909 VKVSLDLCPQRV 920 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = -3 Query: 582 PYPEYCCLIMRSTNKCSLITLEGHP*YCFYW 490 P P C RSTN + H FYW Sbjct: 146 PIPSICAHYYRSTNSTEPVRFVQHLEVKFYW 176 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 24.2 bits (50), Expect = 3.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 334 GTFPSIRPQACPLSIPLFLVSAL 266 G P+I P A P S + L SAL Sbjct: 214 GKIPNILPSALPASTTMVLASAL 236 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 228 FLSMWRVTLCLPRRALTRKRGID 296 F+ + +C P RALT+ RG D Sbjct: 472 FVRVANEAMCRPIRALTQARGYD 494 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 287 GYRQRTRLRSNTW 325 G+ +TR RSNTW Sbjct: 50 GFEPQTRARSNTW 62 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +1 Query: 139 CNVHPADLNTLINAILKETSPSFEKAVIFDFLVCGELLCASLA 267 CN+ ++NT+ +A E +F + + D + E+ LA Sbjct: 16 CNIASININTISSATKLEALKTFIRTMDLDVIFLQEVYHTDLA 58 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,087 Number of Sequences: 2352 Number of extensions: 16636 Number of successful extensions: 80 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -