BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30647 (783 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 24 1.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 6.4 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 24.2 bits (50), Expect = 1.2 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 558 SAAIIPNMVKKIDLAPTVESDAAAVPEIKTPEAADAPKLADNPVDEDKPADI-SPDAPKA 734 S +++ +M+ ++ P+ ++D + V +TP + DN E KP D+ S D Sbjct: 445 STSVVGDMLN-MNWNPSAQNDLSGVNLSETPSGISSLLNLDNQQLELKPIDLNSGDLSML 503 Query: 735 EAKSADDSAT 764 E + ++ T Sbjct: 504 ETNNLSETFT 513 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +3 Query: 645 TPEAADAPKLADNPVDEDKPADISPDAPKAEAKSAD 752 T + PK V+ED P+ S +P+ + S D Sbjct: 97 TNQEIRGPKRKTWKVEEDSPSPTSSVSPEVKDSSRD 132 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,897 Number of Sequences: 336 Number of extensions: 2120 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -