BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30636 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14040.1 68417.m02169 selenium-binding protein, putative cont... 27 8.2 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 27 8.2 >At4g14040.1 68417.m02169 selenium-binding protein, putative contains Pfam profile PF05694: 56kDa selenium binding protein (SBP56); similar to Putative selenium-binding protein (Swiss-Prot:O23264) [Arabidopsis thaliana]; similar to selenium binding protein (GI:15485232) [Arabidopsis thaliana] Length = 487 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +3 Query: 126 TFSSA-HRLHSPFLSDEENKKVYGKCNNPNGHGHNYVVLVTVKGPVDPQTGMVMNITDLK 302 TFSS HRL P++ DE + + C++ +G + + G + + + TD K Sbjct: 69 TFSSVIHRLKMPYIGDELHHTGWNSCSSCHGDASADRRYLVLPGLISGRIYAIDTKTDPK 128 Query: 303 KYIKTAILEP 332 ++EP Sbjct: 129 APSLYKVVEP 138 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 78 NYTMSSLPIVSIIRRETFSSAHRLHSPFLSDEENKKVY 191 N SS VS + +T SS HR F+S +++ Y Sbjct: 600 NIAQSSFYHVSELYEDTLSSFHRFRPQFISSSDSQPTY 637 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,095,258 Number of Sequences: 28952 Number of extensions: 262251 Number of successful extensions: 648 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -