BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30632 (644 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011089-1|AAR82755.1| 770|Drosophila melanogaster RE66734p pro... 63 3e-10 AE014298-1159|AAN09230.1| 731|Drosophila melanogaster CG2286-PB... 63 3e-10 AE014298-1158|AAF46356.1| 731|Drosophila melanogaster CG2286-PA... 63 3e-10 >BT011089-1|AAR82755.1| 770|Drosophila melanogaster RE66734p protein. Length = 770 Score = 63.3 bits (147), Expect = 3e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 469 GKLDVKLKQLEDYFMTDPISRASPTMAKCIQAVIKQKQ 582 G +D+KLK+L DYFMTD ISRASPTMAKCI AV KQ++ Sbjct: 723 GAIDIKLKELRDYFMTDAISRASPTMAKCISAVNKQQR 760 >AE014298-1159|AAN09230.1| 731|Drosophila melanogaster CG2286-PB, isoform B protein. Length = 731 Score = 63.3 bits (147), Expect = 3e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 469 GKLDVKLKQLEDYFMTDPISRASPTMAKCIQAVIKQKQ 582 G +D+KLK+L DYFMTD ISRASPTMAKCI AV KQ++ Sbjct: 684 GAIDIKLKELRDYFMTDAISRASPTMAKCISAVNKQQR 721 >AE014298-1158|AAF46356.1| 731|Drosophila melanogaster CG2286-PA, isoform A protein. Length = 731 Score = 63.3 bits (147), Expect = 3e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 469 GKLDVKLKQLEDYFMTDPISRASPTMAKCIQAVIKQKQ 582 G +D+KLK+L DYFMTD ISRASPTMAKCI AV KQ++ Sbjct: 684 GAIDIKLKELRDYFMTDAISRASPTMAKCISAVNKQQR 721 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,451,238 Number of Sequences: 53049 Number of extensions: 711822 Number of successful extensions: 1548 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1545 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2724262200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -