BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30630 (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 28 0.17 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 26 0.91 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 2.8 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 3.7 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 3.7 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 3.7 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 3.7 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 3.7 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 4.9 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 4.9 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 4.9 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 4.9 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 4.9 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 6.4 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 8.5 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 23 8.5 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 8.5 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 28.3 bits (60), Expect = 0.17 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 217 ARGRQAAQRRLPATEQLFVVRSLLPVLQDGGHAEEHH 327 ARGR A T Q F + + + V DG +EHH Sbjct: 781 ARGRAKALADADFTRQSFAILNEMAVDDDGATVDEHH 817 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.8 bits (54), Expect = 0.91 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 301 DGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHP 405 DG + HH ++ V +GG GA G+ P Sbjct: 936 DGRWTYQQHHTVKTVTTQGGGGGAGTTNGYPAHEP 970 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 2.8 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHPRRHGQRALPALLHEVQGPS 462 LLPV G A H + H A A+ G V P + Q + PA++ + P+ Sbjct: 19 LLPVAHHGSIASSHSTIQHHAAP------AIHHVGSVHAAPAIY-QHSAPAIVKTIAQPT 71 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 3.7 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHPRRHGQRALPALLHEVQGPS 462 LLPV G A H + H A A+ G V P + Q + PA++ + P+ Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAP------AIHHVGSVHAAPAIY-QHSAPAIVKTIAQPT 71 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 3.7 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHPRRHGQRALPALLHEVQGPS 462 LLPV G A H + H A A++ G V P + Q + PA++ + P+ Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAP------AIQHVGSVHALPAIY-QHSAPAIVKTIAQPT 71 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 3.7 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHPRRHGQRALPALLHEVQGPS 462 LLPV G A H + H A A+ G V P + Q + PA++ + P+ Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAP------AIHHVGSVHAAPAIY-QHSAPAIVKTIAQPT 71 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 3.7 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERH--PRRHGQRALPALLHEVQG 456 LLPV G A H + H A G+V + +H P + Q + PA++ + Sbjct: 19 LLPVAHHGSIATSHSSIQHHAAPAIHHVGSVHAAPAIYQHSAPAIY-QHSAPAIVKTIAQ 77 Query: 457 PS 462 P+ Sbjct: 78 PT 79 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 3.7 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHPRRHGQRALPALLHEVQGPS 462 LLPV G A H + H A A+ G V P + Q + PA++ + P+ Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAP------AIHHVGSVHAAPAIY-QHSAPAIVKTIAQPT 71 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 4.9 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERH--PRRHGQRALPALLHEVQG 456 LLPV G A H + H A G+V + +H P + Q + PA++ + Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIY-QHSAPAIVKTIAQ 77 Query: 457 PS 462 P+ Sbjct: 78 PT 79 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 4.9 Identities = 19/72 (26%), Positives = 28/72 (38%) Frame = +1 Query: 247 LPATEQLFVVRSLLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERHPRRHGQRA 426 L AT V LLPV G A H + H A A+ G + P + Q + Sbjct: 7 LLATLVAAVSAGLLPVANHGSIATSHSSIQHHAAP------AIHHVGSIHAAPAIY-QHS 59 Query: 427 LPALLHEVQGPS 462 P ++ + P+ Sbjct: 60 APTIVKTIAQPT 71 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 4.9 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERH--PRRHGQRALPALLHEVQG 456 LLPV G A H + H A G+V + +H P + Q + PA++ + Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAPTIQHVGSVHAAPAIYQHSAPAIY-QHSAPAIVKTIAQ 77 Query: 457 PS 462 P+ Sbjct: 78 PT 79 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 4.9 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERH--PRRHGQRALPALLHEVQG 456 LLPV G A H + H A G+V + +H P + Q + PA++ + Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIY-QHSAPAIVKTIAQ 77 Query: 457 PS 462 P+ Sbjct: 78 PT 79 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.4 bits (48), Expect = 4.9 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 283 LLPVLQDGGHAEEHHHVLRHVAARGGVHGAVRQQGHVERH--PRRHGQRALPALLHEVQG 456 LLPV G A H + H A G+V + +H P + Q + PA++ + Sbjct: 19 LLPVAHHGSIATSHSTIQHHAAPTIQHVGSVHAAPAIYQHSAPAIY-QHSAPAIVKTIAQ 77 Query: 457 PS 462 P+ Sbjct: 78 PT 79 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 6.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 180 SARRPSRKLTRSRSRSPSC 236 S R P R+ RS R PSC Sbjct: 253 SRRNPRRRSPRSGGRWPSC 271 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 316 EEHHHVLRHVAARGGVHG 369 E H HV+R V+A G +G Sbjct: 335 ERHKHVVRLVSAIGDTYG 352 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 316 EEHHHVLRHVAARGGVHG 369 E H HV+R V+A G +G Sbjct: 188 ERHKHVVRLVSAIGDTYG 205 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 316 EEHHHVLRHVAARGGVHG 369 E H HV+R V+A G +G Sbjct: 335 ERHKHVVRLVSAIGDTYG 352 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,307 Number of Sequences: 2352 Number of extensions: 7117 Number of successful extensions: 53 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -