BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30620 (675 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) 140 7e-34 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 42 6e-04 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 41 8e-04 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 41 0.001 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.001 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 40 0.002 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 38 0.006 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 38 0.010 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 38 0.010 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 37 0.013 SB_732| Best HMM Match : AAA (HMM E-Value=0) 37 0.013 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) 36 0.023 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) 35 0.052 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 34 0.091 SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.091 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 34 0.12 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) 33 0.28 SB_58530| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 31 1.1 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 30 2.0 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) 29 2.6 SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) 29 3.4 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 29 3.4 SB_28334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_16986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_10435| Best HMM Match : PRAI (HMM E-Value=1.7) 29 3.4 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 29 3.4 SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) 29 3.4 SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 29 4.5 SB_42542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) 29 4.5 SB_56551| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=0.0049) 28 6.0 SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 28 7.9 SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) 28 7.9 SB_30681| Best HMM Match : An_peroxidase (HMM E-Value=4.3e-29) 28 7.9 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 28 7.9 SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 140 bits (340), Expect = 7e-34 Identities = 81/172 (47%), Positives = 110/172 (63%) Frame = +2 Query: 125 AHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAGRALLLAGPPGTGK 304 AHSHI+GLGLD+ Q++ G+VGQ +AR AAGI+++MI+ K+AGRA+L+AG PGTGK Sbjct: 123 AHSHIRGLGLDDALEARQVSQGMVGQVTARRAAGIILEMIKEGKIAGRAVLIAGQPGTGK 182 Query: 305 TAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVT 484 TAIA+ +AQ LG PF + GSE++S E+ KTE L + + L + ET E+ EGEV Sbjct: 183 TAIAMGMAQSLGPDTPFTSIAGSEIFSLEMSKTEALTQ---PSESLLVEET-EIIEGEVV 238 Query: 485 ELTPVETENPAGGYGKTVSHVIIGLKTAKGTKQLKLDPTIYESLQKEKVKLG 640 E V+ + P G G V + LKT + L + ESL KEKV+ G Sbjct: 239 E---VQIDRPTTGTGAKVGK--LTLKTTEMETIYDLGTKMIESLTKEKVQAG 285 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 376 + +L+GPPGTGKT +A A+A E G VPF + GSE Sbjct: 82 KGAILSGPPGTGKTLLAKAVAGEAG--VPFLSISGSE 116 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 41.1 bits (92), Expect = 8e-04 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LMENFRRA 433 R +LL GP GTGKT IA A+A E G FC + G EV S +TE L E F A Sbjct: 291 RGILLYGPSGTGKTMIARAVANETGVHF-FC-INGPEVLSRYYGETEARLREIFTEA 345 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 376 + LL GPPGTGKT +A A+A E VPF M GS+ Sbjct: 159 KGALLVGPPGTGKTLLAKAVATE--ADVPFLSMAGSD 193 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 40.7 bits (91), Expect = 0.001 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 1/104 (0%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRAIGLRI 448 LLL GPPGTGKT +A +A+E G + F + G E+ S I +E + + F RA + Sbjct: 704 LLLYGPPGTGKTLLAGVVAKECG--LNFISIKGPELLSKYIGASEQAVRDMFTRA---QS 758 Query: 449 RETKEVYEGEVTELTPVETENPAGGYGKTVSHVIIGLKTAKGTK 580 + ++ E L P + G + V+ ++ L +G K Sbjct: 759 AKPCILFFDEFDSLAPRRGHDSTGVTDRVVNQLLTQLDGVEGLK 802 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 433 +LLAGPPG GKT +A AIA E G + F + G E+ + + ++E + + F+RA Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPELLNMYVGESERAVRQVFQRA 72 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 227 IVVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGT 343 ++ D + + R +L+ GPPGTGKT +A A+A E GT Sbjct: 271 LMPDYFQGIRRPWRGVLMVGPPGTGKTMLAKAVATECGT 309 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 2/75 (2%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGS--EVYSTEIKKTEVLMENFRRAIGLR 445 ++L GPPG+GKT +A I + + P + S + + TE++KTE E +R ++ Sbjct: 1252 IILRGPPGSGKTHVAKLIKDKEVSSGAHAPRILSLDDYFLTEVEKTEKDPETGKR---IK 1308 Query: 446 IRETKEVYEGEVTEL 490 + T+ VYE E+ E+ Sbjct: 1309 KKVTEYVYEPEMEEV 1323 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 39.5 bits (88), Expect = 0.002 Identities = 27/65 (41%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = +2 Query: 203 ESAREAAGIVVDMIRS----KKMAGR---ALLLAGPPGTGKTAIALAIAQELGTKVPFCP 361 + A+E VV+ +R+ K++ G+ +LL G PGTGKT +A A+A E G VPF Sbjct: 137 DEAKEELQEVVEFLRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAG--VPFFF 194 Query: 362 MVGSE 376 GSE Sbjct: 195 CSGSE 199 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 38.3 bits (85), Expect = 0.006 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI-KKTEVLMENFRRAIGL 442 + +LL GPPGTGKT A A+A T F ++GSE+ + + ++ E F A Sbjct: 119 KGVLLFGPPGTGKTLCARAVANR--TDACFIRVIGSELVQKYVGEGARMVRELFEMA--- 173 Query: 443 RIRETKEVYEGEVTELTPVETENPAGG 523 R ++ V+ E+ + ++ AGG Sbjct: 174 RTKKACIVFFDEIDAIGGARFDDGAGG 200 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 37.5 bits (83), Expect = 0.010 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 4/99 (4%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELG---TKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 433 R +L GPPGTGKT +A A+A E KV F G++ S + ++E L F +A Sbjct: 919 RGVLFFGPPGTGKTLVARALANECSQGDKKVSFFMRKGADCLSKWVGESERQLRLLFDQA 978 Query: 434 IGLRIRETKEVYEGEVTELTPVETENPAGGYGKTVSHVI 550 +R ++ E+ L PV + + VS ++ Sbjct: 979 YAMR---PSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLL 1014 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 275 LLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS-TEIKKTEVLMENFRRAI 436 LL GPPG GKT +A AIA EL ++PF + +E+ S + E + E F A+ Sbjct: 714 LLHGPPGCGKTLLAHAIAGEL--EMPFLKLAATEIVSGVSGESEEKVRELFTSAV 766 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 37.1 bits (82), Expect = 0.013 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +2 Query: 194 VGQESAREAAGIVVDMIRSKKMAG----RALLLAGPPGTGKTAIALAIAQELGTKVPFCP 361 + ++ REA + + K G R +LL GPPG GKT +A A+A T F Sbjct: 171 IQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPPGCGKTMLAKAVAHH--TTAAFIR 228 Query: 362 MVGSE 376 +VGSE Sbjct: 229 VVGSE 233 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 37.1 bits (82), Expect = 0.013 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +2 Query: 230 VVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE 406 VVD + K + G +LL GPPGTGKT +A I L T+ P + G EV + + ++E Sbjct: 173 VVDKMGLKHVKG--ILLFGPPGTGKTLMARQIGTMLNTREPKI-ISGPEVLNKFVGESE 228 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 379 +LLAGPPG GKT +A AIA E G + F + G E+ Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPEL 53 >SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) Length = 568 Score = 36.3 bits (80), Expect = 0.023 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELG 340 +A LL+GPPG GKT A + QELG Sbjct: 272 KAALLSGPPGVGKTTTATLVCQELG 296 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 35.9 bits (79), Expect = 0.030 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 379 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 212 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 247 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 35.5 bits (78), Expect = 0.040 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LMENFRRA 433 +LL GPPGTGKT +A A+A E + F + G E+ + + ++E + E F RA Sbjct: 847 VLLYGPPGTGKTLMAKAVATE--CSLNFLSVKGPELINMYVGQSEQNVREVFSRA 899 >SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) Length = 230 Score = 35.1 bits (77), Expect = 0.052 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMV 367 LL GPPGTGKT+ LA+A++L F MV Sbjct: 13 LLFYGPPGTGKTSTILAVAKQLYPDKQFGSMV 44 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 35.1 bits (77), Expect = 0.052 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 379 + ++L G PGTGKT +A A+A + T F +VGSE+ Sbjct: 415 KGVILYGQPGTGKTLLAKAVANQ--TSATFLRVVGSEL 450 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 34.3 bits (75), Expect = 0.091 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 245 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 379 R+K M R LL GPPGTGKT A ++A+ G + + M G +V Sbjct: 324 RNKGMY-RNLLFYGPPGTGKTMFAKSLARHSG--MDYAVMTGGDV 365 >SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 34.3 bits (75), Expect = 0.091 Identities = 30/91 (32%), Positives = 41/91 (45%) Frame = +2 Query: 269 ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRI 448 A+L+ GP G GKTA A A ELG K C S+ ++ ++E+ R L Sbjct: 30 AMLVVGPRGAGKTASIYACAGELGYKDVECDTDASQGVVSD------MLEDTRTESMLAE 83 Query: 449 RETKEVYEGEVTELTPVETENPAGGYGKTVS 541 T E +VT T V+ P +G T S Sbjct: 84 AMTTESQSLQVTPGTAVDGPLPRVHFGLTES 114 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 182 AAGLVGQESAREAAGI-VVDMIR-SKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPF 355 A+G+ + RE AG V+D + S ++ +LL GP G+GKT +A IA+ L Sbjct: 241 ASGVQSSSTVRETAGSEVLDAEQDSIRLDKSNILLLGPTGSGKTLLAQTIARCLDVPFAI 300 Query: 356 C 358 C Sbjct: 301 C 301 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +2 Query: 260 AGRALLLAGPPGTGKTAIALAIAQELGTK 346 A R +LL GP GTGKT++A + Q+L K Sbjct: 1753 AKRPVLLTGPVGTGKTSVAQKVLQKLDPK 1781 >SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELGTKV 349 + LL GPPG GKT +A IAQ G V Sbjct: 381 KVALLCGPPGLGKTTLAHVIAQHAGYNV 408 >SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) Length = 1199 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 269 ALLLAGPPGTGKTAIALAIAQELGTKV 349 A+L+ GP G GKTA A A ELG KV Sbjct: 640 AMLVVGPRGAGKTASIYACAGELGYKV 666 >SB_58530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 31.9 bits (69), Expect = 0.49 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELG-TKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGL 442 R + + G PG+GKT +A +A+ G T + ++ E + EV RAIG+ Sbjct: 105 RVIFVIGGPGSGKTELAKLLAESSGRTHISMGQLLKEEATKDTDRAREV-----ARAIGM 159 Query: 443 RIRETKEVYEGEVTELTPVETENPAGGY 526 + E G ++E T V E GGY Sbjct: 160 GTLVSPEHALGILSE-TIVRGEKNLGGY 186 >SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.1 bits (67), Expect = 0.85 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = +2 Query: 278 LAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTE----IKKTEVLMENFRRAI 436 + GP G+GKTA+ LA+ + L C +V +++++ E + K + L E RA+ Sbjct: 28 IGGPVGSGKTALVLALCKYLRDSCNIC-VVTNDIFTKEDWEFLVKNKALDEKRMRAV 83 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQE 334 + +L GPPG GKT +A AIA E Sbjct: 345 KGVLFYGPPGCGKTLLAKAIANE 367 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +2 Query: 260 AGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI 394 + + +++ GP G GKTA+ +AI +E+ K + G+ + +I Sbjct: 506 SNQVVMVTGPVGCGKTALLMAILKEIPLKQGSVTLCGTVAFVDQI 550 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 260 AGRALLLAGPPGTGKTAIALAIAQELGTKVP 352 AG +LL GP G+GKT + +A G P Sbjct: 117 AGSGVLLEGPVGSGKTCLVEHVASMCGRSTP 147 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQELG 340 R +LL G PG GKT++ AIA+ G Sbjct: 1618 RPILLEGSPGVGKTSLVSAIAKASG 1642 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 275 LLAGPPGTGKTAIALAIAQEL 337 ++ GPPGTGKT I L +A+ L Sbjct: 875 VIQGPPGTGKTYIGLKVAKVL 895 >SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) Length = 1172 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 269 ALLLAGPPGTGKTAIALAIAQEL-GTKVPFCPMVGSEVYSTEIKKTEVLME 418 ++++AGPPGTGK++ A+ + L GS +++ +++K V M+ Sbjct: 1099 SIIVAGPPGTGKSSCISALIETLTECSATKHKNTGSPMHTHKLQKAIVYMD 1149 >SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) Length = 569 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +2 Query: 239 MIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTE 391 +I + G L + GP G GK+++ +AI EL + G YS++ Sbjct: 147 LIDNSYFKGELLAIVGPVGAGKSSLLMAILGELPFTEGTITVKGKIAYSSQ 197 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 266 RALLLAGPPGTGKTAIALAIAQEL 337 R LL GPPG GK++ A+A EL Sbjct: 223 RGYLLYGPPGCGKSSFIQALAGEL 246 >SB_28334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = -1 Query: 522 PPAGFSVSTGVNSVTSPSYTSLVSRIRRPIARRKFSINTSVFLISVL*TSLPTI--GQKG 349 PP+ + T N +SP R+P A +K +N +V + ++P + +KG Sbjct: 35 PPSAIQIPTNGNGRSSPEARVPTIGTRKPAASKKKGVNMAVVISKKKGVTMPVVISKKKG 94 Query: 348 TLVP 337 +P Sbjct: 95 VTMP 98 >SB_16986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 615 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 271 SSPGHFLTSYHIYNYPCSLTCRLLTHETGCHLNRNTIFIQPQAFYM 134 S+P ++ H C R LT + GC + R T++I+ A Y+ Sbjct: 226 STPHTPESTSHTPESKCDYIRRALTRKEGCTIKRQTVYIKMPAEYL 271 >SB_10435| Best HMM Match : PRAI (HMM E-Value=1.7) Length = 379 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Frame = +2 Query: 77 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQES----AREAAGIVVDMI 244 MK + K +K + H + L LD + P A G G+++ ARE I+V Sbjct: 150 MKALKTKKFSKLEFCLRHPYTIALSLDCSTHPAGTATG--GEQTKVADAREKLAILVASG 207 Query: 245 RSKKMAGRAL 274 +S++M GRAL Sbjct: 208 KSREMVGRAL 217 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTK 346 +LL GPPG GKT + + Q L ++ Sbjct: 54 VLLTGPPGIGKTTLCSKVKQALASR 78 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +2 Query: 230 VVDMIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI 394 V+ I K R + + GP G+GK+++ LAI E+ + G VY ++ Sbjct: 263 VLSDITLKLKGSRLIGITGPCGSGKSSLLLAILNEMSLISGEAVVQGETVYVPQV 317 >SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) Length = 486 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +2 Query: 251 KKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPM 364 KK G +L ++G PGTGKTA + +++ +V CP+ Sbjct: 232 KKKPG-SLYISGAPGTGKTACLTMVIRDM-KEVSDCPV 267 >SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTK 346 +L+ G PGTGK+ + +A LG K Sbjct: 11 ILITGTPGTGKSTTGVELANRLGFK 35 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 278 LAGPPGTGKTAIALAIAQEL 337 L GPPGTGKT L +A+ L Sbjct: 869 LEGPPGTGKTTSILCLARAL 888 >SB_42542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/74 (24%), Positives = 35/74 (47%) Frame = +2 Query: 242 IRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMEN 421 I+ K + +++ GP G GK+++ L+I E+ + G Y +I + + E Sbjct: 176 IKLKAVCDDLVIITGPVGGGKSSLLLSILGEIPLISGSISVRGRIAYFPQIPFGKQMEEE 235 Query: 422 FRRAIGLRIRETKE 463 R IG I + ++ Sbjct: 236 SREKIGQDISQRED 249 >SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) Length = 786 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 278 LAGPPGTGKTAIALAIAQEL 337 + GPPG GK+ +A+ +A EL Sbjct: 132 ITGPPGFGKSCVAIHVAHEL 151 >SB_56551| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=0.0049) Length = 113 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 151 PQAFYMTVSRDPLRFSCAFHFFNFHVESSFTLLN 50 P YM R P R F+FF F + + T LN Sbjct: 4 PSKAYMQTRRFPKRHISIFNFFTFSCKQAVTFLN 37 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVG 370 ++L GP G GK+++ +AI E+ K F +G Sbjct: 589 VILTGPVGGGKSSLLMAILGEIPLKRGFIKAIG 621 >SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) Length = 514 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 257 MAGRALLLAGPPGTGKTAIALAIAQEL 337 ++ R ++ GPPG GKT + + I Q L Sbjct: 388 LSNRLAIVQGPPGCGKTFLGVKIVQLL 414 >SB_30681| Best HMM Match : An_peroxidase (HMM E-Value=4.3e-29) Length = 576 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 262 GHFLTSYHIYNYPCSLTCRLLTHETGCHLNRNTIFIQ 152 G F S H+ + PC L+ + T+E L+ +TIF++ Sbjct: 401 GGFCRSPHVQSMPCFLSGDMRTNENPGLLSMHTIFLR 437 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 272 LLLAGPPGTGKTAIALAIAQEL 337 +++AGPPGTGK++ A+ + L Sbjct: 2 IIVAGPPGTGKSSCISALIETL 23 >SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 150 GWMKMVFLFKWQPVSWV 200 G++K FLF+++P SWV Sbjct: 9 GYIKAYFLFEYEPTSWV 25 >SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 663 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 278 LAGPPGTGKTAIALAIAQELGTKVP 352 + GPPGTGKT +A+ I + P Sbjct: 590 VVGPPGTGKTDVAVQIISNIYHNFP 614 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,676,296 Number of Sequences: 59808 Number of extensions: 431959 Number of successful extensions: 1542 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1540 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -