BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30605 (718 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 428 EQHNITLFSLREGLDRANIMLDRKSLSDLASWEPKTFEALAAVAKYKLE 574 EQH+ TLFS E LD N K + D ++ E ++ LA+ + ++ E Sbjct: 621 EQHSETLFSFLEILDDFNSSTIAKPMDDSSAVEQMEYQPLASTSDFRSE 669 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -2 Query: 633 RFRFIPVG*HLSCPSMNLSVSSLYLATAARASNVFGSHEAKSDK 502 R P G L PSM S +S T+A S+ +G EAK K Sbjct: 1613 RLALTPTGPALMSPSMRDSSASKIAYTSAGQSSSWGQDEAKPSK 1656 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,209,090 Number of Sequences: 59808 Number of extensions: 379709 Number of successful extensions: 743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -