BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30605 (718 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117203-7|CAB55109.1| 191|Caenorhabditis elegans Hypothetical ... 53 2e-07 AF068710-2|AAC17770.1| 476|Caenorhabditis elegans Hypothetical ... 29 2.5 AF022971-3|AAG23977.1| 474|Caenorhabditis elegans Hypothetical ... 29 3.3 Z92837-4|CAH10846.1| 193|Caenorhabditis elegans Hypothetical pr... 28 5.8 >AL117203-7|CAB55109.1| 191|Caenorhabditis elegans Hypothetical protein Y48C3A.10 protein. Length = 191 Score = 53.2 bits (122), Expect = 2e-07 Identities = 30/107 (28%), Positives = 53/107 (49%) Frame = +2 Query: 242 PDEFWRKRRVFRLAAHYIGRRRNCYSIAVRNVHRALVYATKARKLKKEDMKSLWDVRITA 421 PD + ++ R+ R A R+ A R + Y R+ ++ K + R+ Sbjct: 26 PDVWMKRERLNRFTAWQYASERSTVKGAYRKEDKIFAYLNMQRQDERNLEKFHAEERVRT 85 Query: 422 ACEQHNITLFSLREGLDRANIMLDRKSLSDLASWEPKTFEALAAVAK 562 A E+H++ + L +++I+LD LS LA +EP++F +L A AK Sbjct: 86 ALEEHDMEYSKFKSILSQSHILLDNICLSQLAIYEPRSFRSLVAFAK 132 >AF068710-2|AAC17770.1| 476|Caenorhabditis elegans Hypothetical protein T06A1.5 protein. Length = 476 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = -3 Query: 362 WLHKLELGEHFELQSNNNFV-----DGQYNERLI*KPVAFSKI 249 WLH EL EH++LQ N F G+Y+ +L+ VA ++ Sbjct: 226 WLHFAELVEHYKLQGVNKFFIYIREIGEYDMKLVKSYVASGEV 268 >AF022971-3|AAG23977.1| 474|Caenorhabditis elegans Hypothetical protein C31B8.7 protein. Length = 474 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 362 WLHKLELGEHFELQSNNNF 306 WLH +EL EH++LQ N F Sbjct: 224 WLHFVELVEHYKLQGVNKF 242 >Z92837-4|CAH10846.1| 193|Caenorhabditis elegans Hypothetical protein R03E1.4 protein. Length = 193 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 524 EPKTFEALAAVAKYKLETDRFIDGQDKCHPTGINLNLKDVMLEAWLN 664 EP + E +++ A+Y+LE + + + N K V+LEA++N Sbjct: 88 EPPSSEIVSSQAQYRLENMKLLSNVPETFNVAGPSNSKMVLLEAYMN 134 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,511,603 Number of Sequences: 27780 Number of extensions: 306004 Number of successful extensions: 676 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -