BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30604 (669 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 27 0.71 U21917-1|AAA73920.1| 271|Anopheles gambiae serine protease prot... 24 5.0 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 26.6 bits (56), Expect = 0.71 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 476 NFLPLFLYCFLVNIEPILFRGTK*RCYFIALFSNGHV 586 N P C L+ +EP+ R +C FIA NG + Sbjct: 940 NLPPYAARCRLLGLEPLSVRRRNAQCSFIAGLLNGSI 976 >U21917-1|AAA73920.1| 271|Anopheles gambiae serine protease protein. Length = 271 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 138 LKAIGLIRLVSNIIFHNRHRNSGVPG 61 L A+ + LVS + FH +N +PG Sbjct: 11 LAALAYLALVSGVRFHLSEQNDVLPG 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,861 Number of Sequences: 2352 Number of extensions: 12280 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -