BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30601 (775 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 23 3.6 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 6.3 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 6.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 6.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 6.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 6.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 6.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 6.3 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 6.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 6.3 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 6.3 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 8.3 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.6 bits (46), Expect = 3.6 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +3 Query: 63 IKTFRPSVRALSAEKPAESESNDKLPATIEECHKQIESLTNEVNSIKEQFNDINDKYKRA 242 +K VRA +A K + N +++ H++ + N + +KE D N K A Sbjct: 293 LKDTEAEVRAAAANKVKDFCQN------LDKAHQESIIMNNILPCVKELVADPNQHVKSA 346 Query: 243 LA 248 LA Sbjct: 347 LA 348 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 168 IESLTNEVNSIKEQFNDINDKYKR 239 I+ T ++ + EQF+ I D Y++ Sbjct: 65 IDEETYKLTPLNEQFDVIKDNYRK 88 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 44 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 78 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 559 APSTSCWNNASCRFGSNFSRRGDTGTRPCRANTCP 455 +P+T +ASC++ + S G + N P Sbjct: 88 SPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 135 LPATIEECHKQIESLTNEVNSIKEQFND 218 LP + CH +IES + I+ ++N+ Sbjct: 174 LPMDRQLCHIEIESFGYTMRDIRYKWNE 201 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 165 QIESLTNEVNSIKEQFNDI 221 +IESL E+ + + FNDI Sbjct: 181 KIESLACELKNTVDDFNDI 199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,675 Number of Sequences: 336 Number of extensions: 3101 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -