BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30597 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1032 - 29861859-29862011,29862347-29862470,29862557-298627... 86 2e-17 01_01_0172 + 1485170-1485176,1485480-1485511,1485622-1485870,148... 31 0.97 06_03_0785 - 24563310-24565004,24565302-24565384,24565484-245660... 29 3.9 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 28 6.9 03_02_0278 + 7060456-7060583,7060700-7060814,7060910-7061026,706... 28 9.1 >03_05_1032 - 29861859-29862011,29862347-29862470,29862557-29862759, 29863081-29863199,29863489-29863623,29863695-29863950, 29864749-29864880,29865001-29865222 Length = 447 Score = 86.2 bits (204), Expect = 2e-17 Identities = 48/160 (30%), Positives = 71/160 (44%) Frame = +3 Query: 264 GSLGDCSCKVDTIDFFNNVKIFPRIQSIVTKDYFRFYKVNLKKECPFWADDSRCAMKYCH 443 G + DC C +T+D N + P +Q +VT +FR++KV L +CPFW DD C ++ C Sbjct: 81 GMVEDCCCDYETVDAINEEVLHPILQELVTLPFFRYFKVKLWCDCPFWPDDGMCRLRDCS 140 Query: 444 IKTCTKESVPGYETGYNNEYVDETPATKYSKEAQSDCKSDLDHDPQLSYLNMTISAANQY 623 + C + P + Y +P + +E + D D ++ I N + Sbjct: 141 VCECPENEFP---EPFKKPYSGLSPDSMICQEGKPQATVDRTLDAKV--FKGWIETDNPW 195 Query: 624 EIAKWKVHDDAHDNFCESXXXXXXXXXXXLTLNPERYTGY 743 +DD DN E L LNPERYTGY Sbjct: 196 ------TYDDETDNVAEKNIISAEMTYVNLQLNPERYTGY 229 >01_01_0172 + 1485170-1485176,1485480-1485511,1485622-1485870, 1486350-1487813,1487906-1487959 Length = 601 Score = 31.1 bits (67), Expect = 0.97 Identities = 18/64 (28%), Positives = 28/64 (43%) Frame = +3 Query: 174 LFALAIVQAVGYDTELTKPCDSTACFDELHGSLGDCSCKVDTIDFFNNVKIFPRIQSIVT 353 L +++ DT + PCD D+LH + D S VD + N+ + P I Sbjct: 230 LLGAYVIEKPEVDTPMDLPCDD----DDLHLVIADRSFNVDGSLYMNSTGVAPNIHPQWA 285 Query: 354 KDYF 365 +YF Sbjct: 286 PEYF 289 >06_03_0785 - 24563310-24565004,24565302-24565384,24565484-24566039, 24566397-24566513,24566565-24567131,24568632-24568702, 24569833-24569903,24570270-24570441,24571229-24572212, 24573128-24574808 Length = 1998 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 16 LLSPCRDYSLVYHTYITVVYVRS-EATFVSAIIL---MSWRGHPQRCH 147 LL+P R+Y +V++ YI + + ++VS +L + W+G CH Sbjct: 942 LLNPGRNYGMVFYVYIGEICSEPVKISYVSLQLLYGFLFWKGKKNLCH 989 >01_07_0122 - 41196081-41196205,41197561-41198245,41198961-41199329, 41199405-41199514,41200539-41200833 Length = 527 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -2 Query: 510 HLHTHYYIQFHSQVHFPSCKSLYGSISLHTYCHQPRTGIP 391 H H H++ H H S S +H H+PR G P Sbjct: 349 HHHGHHHHHHHHHGHEDSRHSAPAQAPVHYPVHEPRYGAP 388 >03_02_0278 + 7060456-7060583,7060700-7060814,7060910-7061026, 7061142-7061282 Length = 166 Score = 27.9 bits (59), Expect = 9.1 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = -1 Query: 322 FTLLKKSIVSTLQEQSPKDPWSSSKQAVLSQGF 224 F ++K +++ T++E+ P D WS + ++ S+ + Sbjct: 119 FEVVKFALLDTIKEEVPADMWSPAMKSAWSEAY 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,406,326 Number of Sequences: 37544 Number of extensions: 360569 Number of successful extensions: 965 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -