BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30594 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0671 - 24164490-24164544,24164920-24165086,24165787-241659... 28 6.6 11_06_0293 + 22018128-22018556 28 8.8 01_01_0778 + 6024154-6024315,6024725-6024802,6024909-6025071,602... 28 8.8 >01_05_0671 - 24164490-24164544,24164920-24165086,24165787-24165941, 24166291-24166458,24167471-24167552 Length = 208 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 11 SGRSKLRILDCLLSGLSVNIGIIYTSVEFYLSRTPAR 121 +G S + LL GL GI++TS +YL RT R Sbjct: 160 NGMSGWLVALILLLGLGAIGGIVFTSYTYYLRRTSGR 196 >11_06_0293 + 22018128-22018556 Length = 142 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 370 AAPPFKPKRITASRQK*AGWLYLLLRTHQTSYHPFVTKTVLG 495 AA P +P R+ R+ W+ LLR ++T + + V G Sbjct: 43 AALPSRPPRVRLDRRSVVAWIKRLLRVNKTGHSGTLDPKVTG 84 >01_01_0778 + 6024154-6024315,6024725-6024802,6024909-6025071, 6025484-6025788,6025897-6025961,6026570-6026763, 6027233-6027441,6028147-6028325,6029345-6029459, 6029520-6029558 Length = 502 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 226 PFTRKPTGTKVGVFWIPKGFCLRKGSFGTT 315 PF RKPT G+F++P G + + G++ Sbjct: 165 PFYRKPTPAMGGLFFVPIGIFVARRQVGSS 194 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,992,826 Number of Sequences: 37544 Number of extensions: 451889 Number of successful extensions: 839 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -