BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30594 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45080| Best HMM Match : DAGAT (HMM E-Value=0) 30 1.7 SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) 29 3.9 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 29 5.1 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 >SB_45080| Best HMM Match : DAGAT (HMM E-Value=0) Length = 337 Score = 30.3 bits (65), Expect = 1.7 Identities = 24/75 (32%), Positives = 36/75 (48%) Frame = -3 Query: 410 REAVMRFGLKGGAAVVPFRATIN*DFAVLDIIVVPKEPFLKQKPLGIQKTPTFVPVGFLV 231 R ++ ++ GA++VP A D V + + P+ L++ IQKT F PV F Sbjct: 209 RYGFIKLAIRNGASLVPVYAFGEND--VFNQVSNPRGSMLRRIQTKIQKTVAFAPVLF-- 264 Query: 230 KGYLGRGIHIYGSGV 186 GRGI Y G+ Sbjct: 265 ---YGRGIFQYTFGL 276 >SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) Length = 2865 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 217 PKYPFTRKPTGTKVGVFWIPKGFCLRKGSFGT-TIMSRTAKS*LMVARNGTTAAPPFK 387 P F R T + V VFW P LR+G + + + A S ++ NGTTA K Sbjct: 1414 PDSIFHRHLTTSAVTVFWYPPVRSLRRGRISSYHLKALEANSSGVIITNGTTAEKTVK 1471 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +2 Query: 44 LLSGLSVNIGII-YTSVEFYLSRTPAR--KRLKIVWKRVRESSKGINNNPKLLNRKYVYP 214 L+S +SV+ G+ + V FY++ P R + V+ R + +G+ ++ LLN+ ++ Sbjct: 158 LVSDVSVHPGMSDHDLVHFYINTNPRRATRTPHKVYLFDRMNLEGLQHDMDLLNQSFMVS 217 Query: 215 SLSIPLQEN 241 LS ++EN Sbjct: 218 PLSRSVEEN 226 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +2 Query: 44 LLSGLSVNIGII-YTSVEFYLSRTPAR--KRLKIVWKRVRESSKGINNNPKLLNRKYVYP 214 L+S +SV+ G+ + V FY++ P R + V+ R + +G+ ++ LLN+ ++ Sbjct: 1548 LVSDVSVHPGMSDHDLVHFYINTNPRRATRTPHKVYLFDRMNLEGLQHDMDLLNQSFMVS 1607 Query: 215 SLSIPLQEN 241 LS ++EN Sbjct: 1608 PLSRSVEEN 1616 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,379,198 Number of Sequences: 59808 Number of extensions: 535360 Number of successful extensions: 1069 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -