BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30594 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 29 0.15 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.4 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 9.7 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 29.1 bits (62), Expect = 0.15 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 204 YLRFRSLGLLFIPLLDSRTRFQTIFKRLRAGVR 106 Y+ F +GLLF+PLL + I +L G+R Sbjct: 274 YVLFHDVGLLFLPLLTMGFAYSMIVSKLWRGLR 306 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 237 KTHWHKGRCFLDTQRFLFKEGFLWDYDN 320 +T W K D + F F E F+ ++DN Sbjct: 1728 QTKWTKVHPENDAKMFEFHENFILNFDN 1755 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 9.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 283 NLWVSRKH 260 NLWVSRKH Sbjct: 898 NLWVSRKH 905 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,052 Number of Sequences: 2352 Number of extensions: 18327 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -