BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30592 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.4 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 5.5 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 7.2 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 7.2 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.0 bits (52), Expect = 2.4 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -2 Query: 115 IDFIQT*KSVKKNITSLQVEYIIWTRLASSPFQ 17 I+F K +++ I +++Y +W + S PF+ Sbjct: 1146 IEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFE 1178 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 2.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 102 CIKSIYLHLIKTNGSCNARRC 164 C++ HL+K NG+C R+C Sbjct: 261 CVRKCPEHLLKDNGAC-VRKC 280 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 219 FSSHLCCFIKSILYFISF 272 FSS LCCF+ S+ + ++F Sbjct: 197 FSSSLCCFL-SVWFVVAF 213 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 389 TYLAYYTMTFYAA*LPIRIEYL 454 TY + MT+YA+ + + + YL Sbjct: 161 TYSTFIVMTYYASLMAVTMRYL 182 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 389 TYLAYYTMTFYAA*LPIRIEYL 454 TY + MT+YA+ + + + YL Sbjct: 161 TYSTFIVMTYYASLMAVTMRYL 182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,592 Number of Sequences: 2352 Number of extensions: 11930 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -