BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30590 (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 22 5.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.9 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 9.9 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 484 LRLVIKCHXLA*IMNEASKVEPVLIRV 404 +RL+ C A + +E+SKV P+L V Sbjct: 206 MRLISVCLCGASVHSESSKVLPLLFSV 232 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = -2 Query: 478 LVIKCHXLA*IMNEASKVEPVLIRVILSDPFSGLES 371 +++ CH L+ +M + + V VIL F + + Sbjct: 171 VILACHMLSFLMVHQGETQFVAANVILKTRFKTINN 206 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 666 YSSWLQDISKLSI 628 Y SW+ + SKLS+ Sbjct: 338 YGSWINEESKLSL 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,981 Number of Sequences: 336 Number of extensions: 3441 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -