BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30585 (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 28 7.2 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_11259| Best HMM Match : Peptidase_S8 (HMM E-Value=0) 28 9.5 SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_8927| Best HMM Match : UCH (HMM E-Value=0) 28 9.5 >SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) Length = 681 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 100 DRIRM*CIVNYEYLLESGYLRSSSMYSRSCVITLVPLAYARKVRQ 234 +RI C+ NY +L + G + + S V+T+ PLA + R+ Sbjct: 169 ERILDVCLTNYPFLWKHGSVNKGLVRSDHLVVTVPPLAPVKPSRK 213 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 587 VYTYLYYRFIHTLSDKAFIHLSHTDNFNIFIRANVSVKC 471 V ++LY +++L HL H +F F R+ + VKC Sbjct: 1107 VDSFLYESLLYSLRSAGSQHLWHGKSFKDFSRSLIRVKC 1145 >SB_11259| Best HMM Match : Peptidase_S8 (HMM E-Value=0) Length = 772 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 683 IFLLIALKLVKPRGKLFLNCSVLTYLYCIPLFVYT 579 +FL L++P FL + L Y+YC+ L + T Sbjct: 352 LFLTNVTLLLRPFSPSFLIVAALCYIYCLHLIIVT 386 >SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 614 TYLYCIPLFVYTYLYYRFIHTLSDKAFIHLS 522 TYL CI +Y+ Y+R H L FI LS Sbjct: 516 TYLRCILSSLYSSTYFRCTHRLIFAVFIGLS 546 >SB_8927| Best HMM Match : UCH (HMM E-Value=0) Length = 316 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 175 TSKMIANNPIRVNTRSLQYTTYVFCRFK---NNDARFLCAEHI 56 T+ I NNP N+ TT+V F+ N+ R LC E + Sbjct: 183 TANCIINNPTTTNSNMRTETTWVHEMFEGTLTNETRCLCCESV 225 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,424,621 Number of Sequences: 59808 Number of extensions: 359204 Number of successful extensions: 765 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -