BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30585 (761 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 25 1.9 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 5.9 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +3 Query: 30 WLSFFLNHRMCSAHRNLASLFLKRQNTYVVYCKLRVFTRIGLFAIIFDVF*VLCYYFSSV 209 W+SF++NH SA L + T + + RI I D++ V+C+ F Sbjct: 241 WVSFWINHEATSARVALGITTVLTMTTISTGVRSSL-PRISYVKAI-DIYLVMCFVFVFA 298 Query: 210 SL 215 +L Sbjct: 299 AL 300 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 671 IALKLVKPRGKLFLNCSVLTYLYC 600 I L+ ++ G FL ++ TYLYC Sbjct: 1680 INLERLETIGDSFLKYAITTYLYC 1703 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,973 Number of Sequences: 2352 Number of extensions: 12552 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -