BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30578 (822 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizos... 28 1.4 SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit... 27 3.2 SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosacc... 27 4.3 SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizo... 27 4.3 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 26 7.4 SPBC691.04 |||mitochondrial ATP-dependent RNA helicase Mss116 |S... 25 9.8 >SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 28.3 bits (60), Expect = 1.4 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = -2 Query: 488 CNKIYL*IGLNITIQKTLVFYSHYMNIQKLPKTESEHPTFHMVLSAL 348 C +++L G I + + L+FYS+ + K ++E+P +H LSAL Sbjct: 17 CLRLFL-FGSLILLLRPLIFYSN----TTMKKLKTEYPIYHRHLSAL 58 >SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit Rrn7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 537 Score = 27.1 bits (57), Expect = 3.2 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 7/87 (8%) Frame = +3 Query: 510 SKWFTIISCLHEYLYYHSVKLFILENKTRNFNIVIFNQIYKEILLHL-TILHRH------ 668 S F ++CL L KL +L K NI+ + + YK+I L + L ++ Sbjct: 183 SSAFIYVACLLLRLPLTIHKLEVLIRK----NIIPYYRAYKQIPLKIFKRLQKNYVRMLI 238 Query: 669 PNGLPTLQ*RLTQPVVKLVILLVSKYE 749 P PT Q R+ V+ LV +LVSKYE Sbjct: 239 PFHYPTYQ-RIQSAVLTLVDVLVSKYE 264 >SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 26.6 bits (56), Expect = 4.3 Identities = 21/63 (33%), Positives = 31/63 (49%) Frame = -2 Query: 437 LVFYSHYMNIQKLPKTESEHPTFHMVLSALLLMYI*KPEARSESGPRPV*QSVGTIRGRA 258 LVF S IQ K SE+ T ++LS ++L + PE ++GP + Q R Sbjct: 126 LVFMSSSSLIQSQQKI-SENVTPALILSGIMLGGVCVPELLKKAGPIAIAQGRKAPRQDP 184 Query: 257 DEA 249 DE+ Sbjct: 185 DES 187 >SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1000 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 195 RASAPKGGRAALPAAPEIIQNQTRWGERRSPLSVNNAI 82 R A + GR AL + + +N TR+ +P+SV ++I Sbjct: 104 RRPAGRRGRPALNTSNSLERNGTRYVSAEAPISVKSSI 141 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.8 bits (54), Expect = 7.4 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 40 ATPWRYPWLMLFG*NSIIY*KWGPSFSPSC-LVLNYLRRCGKSSPSAFGC 186 A+ W + W M+ + IY W + L+L Y+R KSS + F C Sbjct: 189 ASIWAFDWPMMNLQETFIY--WDRCTNACLRLLLCYIRYTNKSSETGFSC 236 >SPBC691.04 |||mitochondrial ATP-dependent RNA helicase Mss116 |Schizosaccharomyces pombe|chr 2|||Manual Length = 535 Score = 25.4 bits (53), Expect = 9.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 632 FINLIKYNNIKIPCFILQN 576 F+ + N++KIPCFIL + Sbjct: 307 FVGGVLENHLKIPCFILHS 325 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,763,589 Number of Sequences: 5004 Number of extensions: 82974 Number of successful extensions: 182 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 182 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 402440190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -