BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30578 (822 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0785 - 5873244-5873357,5873458-5873562,5874333-5874424,587... 30 1.9 09_02_0203 - 5746068-5746307,5746469-5746729,5746833-5748239,574... 29 4.5 06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169,588... 29 5.9 05_01_0468 + 3715777-3715810,3716485-3716528,3716572-3716960,371... 28 7.8 >06_01_0785 - 5873244-5873357,5873458-5873562,5874333-5874424, 5874525-5874594,5875080-5875202,5875287-5875372, 5875547-5875648,5875874-5876096,5876217-5876282, 5876407-5876497,5876574-5876701,5877734-5877749, 5878171-5878318,5878440-5878511,5878586-5878690, 5879122-5879291,5880093-5880424 Length = 680 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +2 Query: 263 YLVWYPHSVTLGEGRSHSAPPVFIYTLGVGQTRPCGKLDALIQFWVIFGYS 415 Y +YP S +G PP+ + T G G LD +Q+W G++ Sbjct: 424 YAYFYPPSNPNFQGLPDEKPPLLVKTHGGPTAETRGILDLSVQYWTSRGWA 474 >09_02_0203 - 5746068-5746307,5746469-5746729,5746833-5748239, 5748588-5748714,5748800-5749119,5749202-5749963, 5750749-5750898,5751007-5751096,5751196-5751340, 5751440-5751617,5751753-5752448,5752555-5752753 Length = 1524 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 1 GEWGYPSVSLLPCATPWRYP 60 GE G+PS+ + PC+TP+ P Sbjct: 29 GEIGWPSMEISPCSTPYGTP 48 >06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169, 5882267-5882336,5882639-5882724,5882916-5883017, 5883375-5883597,5883693-5883758,5883896-5883986, 5884019-5884057,5885401-5885548,5885623-5885715, 5885782-5885886,5886645-5886826,5886912-5887084 Length = 566 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 263 YLVWY-PHSVTLGEGRSHSAPPVFIYTLGVGQTRPCGKLDALIQFWVIFGYS 415 Y +Y PH+ + +G S PP+ + T G G LD +Q+W G++ Sbjct: 347 YAYFYAPHN-HIFQGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWA 397 >05_01_0468 + 3715777-3715810,3716485-3716528,3716572-3716960, 3717081-3717330,3717614-3717619 Length = 240 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 504 QASKWFTIISCLHEYLYYHSVKLFILENKTRN-FNIVIFNQIYKEILLHLTILHRHPN 674 + ++ I++C H + Y++S ++ + +K + FNI+I Q Y+ ++ HPN Sbjct: 70 EVENFYYILTCAHLFEYFYSAEIKVDCDKLNSWFNILIICQHYES-----DMIANHPN 122 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,887,541 Number of Sequences: 37544 Number of extensions: 518679 Number of successful extensions: 1229 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2256438528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -