BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30578 (822 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ990877-1|ABJ90145.1| 105|Anopheles gambiae putative salivary ... 25 2.8 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.8 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 4.9 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 6.5 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 24 6.5 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 6.5 AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F pro... 24 6.5 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 8.6 >DQ990877-1|ABJ90145.1| 105|Anopheles gambiae putative salivary secreted peptide protein. Length = 105 Score = 25.0 bits (52), Expect = 2.8 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 236 AFSIQPHLLYLVWYPHSVTLGEGRSHSAPP 325 A ++ HL YL+ Y LG G PP Sbjct: 32 AIALIHHLSYLIDYLVQFVLGSGNDRKTPP 61 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 696 RLTQPVVKLVILLVSKYEFIXWVTLILLLHGLSM 797 RL + +++ L V + WV L+++LH SM Sbjct: 358 RLGTVISRVISLTVYASVYSHWVFLVIILHWFSM 391 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.2 bits (50), Expect = 4.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 461 LNITIQKTLVFYSHYMNIQKLPKTESE 381 L ++KT VF+S N+Q L T E Sbjct: 129 LKHVLEKTQVFFSDKSNVQNLEATGGE 155 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 488 CNKIYL*IGLNITIQKTLVFYS 423 C++ YL I NIT+++ +FY+ Sbjct: 226 CDEPYLDITFNITMRRKTLFYT 247 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 488 CNKIYL*IGLNITIQKTLVFYS 423 C++ YL I NIT+++ +FY+ Sbjct: 226 CDEPYLDITFNITMRRKTLFYT 247 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 488 CNKIYL*IGLNITIQKTLVFYS 423 C++ YL I NIT+++ +FY+ Sbjct: 222 CDEPYLDITFNITMRRKTLFYT 243 >AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F protein. Length = 101 Score = 23.8 bits (49), Expect = 6.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 148 RRCGKSSPSAFGC*STVNS*PALKFRLVGRIQHPASSALP 267 +R G +P+ FG N +RL+GRIQH LP Sbjct: 64 KRGGYLNPAIFGQDEQENL-----YRLIGRIQHFRDEQLP 98 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 187 STQRRKGCSSRSAGDNSEPNKMGRK 113 S+ G SRS D E + +GRK Sbjct: 639 SSTTHSGAPSRSQSDEDEQHSVGRK 663 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 946,003 Number of Sequences: 2352 Number of extensions: 18838 Number of successful extensions: 23 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -