BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30576 (663 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 9.0 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 9.0 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 648 ISFFLHIYFR*AFSCKFFYSIFYRYKAFSYIEEK 547 I F I+F +FF + +R+ FS I K Sbjct: 1283 IGFVFLIFFALLMVIQFFAMMIHRFGTFSQIITK 1316 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 648 ISFFLHIYFR*AFSCKFFYSIFYRYKAFSYIEEK 547 I F I+F +FF + +R+ FS I K Sbjct: 1283 IGFVFLIFFALLMVIQFFAMMIHRFGTFSQIITK 1316 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 400 VTFLVICRGGSITVTIYNLH 341 + ++ IC G +T+ Y LH Sbjct: 153 LAYVWICEMGVVTLQAYTLH 172 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 400 VTFLVICRGGSITVTIYNLH 341 + ++ IC G +T+ Y LH Sbjct: 153 LAYVWICEMGVVTLQAYTLH 172 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,129 Number of Sequences: 336 Number of extensions: 2753 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -