BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30572 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) 29 3.3 SB_30671| Best HMM Match : rve (HMM E-Value=6.2e-32) 28 7.6 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) Length = 197 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -1 Query: 135 MSKSSCFFLISNANCSIEIRISKIKNY 55 M+KSS F I+ +NC +E+R+ K+ + Sbjct: 1 MAKSSRTFTIAISNCYVEVRLRKLNGF 27 >SB_30671| Best HMM Match : rve (HMM E-Value=6.2e-32) Length = 965 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 255 GVLHTHRLVSSKWFFPRWAQALIGTAKICYASEIS 359 G+ T L+ K++FPR + + IC++ ++S Sbjct: 605 GITKTKELLRRKYWFPRMNKRIEDIVSICFSCQVS 639 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 27.9 bits (59), Expect = 7.6 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +3 Query: 492 EAVVTVQGVPLSSYMEDLLTNKISLNAGKGRQAIEWVIGGSLTLKLRSLQVQP 650 E V L + E LL NK+SLN K E+++ GS K+R+L QP Sbjct: 705 EEVEVAMNEDLGNVKEWLLANKLSLNVAK----TEFLVMGS-HYKMRNLPCQP 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,292,881 Number of Sequences: 59808 Number of extensions: 429799 Number of successful extensions: 948 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -