BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30568 (309 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I2C9 Cluster: Putative uncharacterized protein PFA073... 31 5.0 >UniRef50_Q8I2C9 Cluster: Putative uncharacterized protein PFA0735w; n=2; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFA0735w - Plasmodium falciparum (isolate 3D7) Length = 293 Score = 31.1 bits (67), Expect = 5.0 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 293 LLKTFKMKTIYFVLLISVCAVSAIYLPDDSNSADLDKYKSESFGS*LY 150 +LK F K I FV++I + + +YLP+D N+ SE + LY Sbjct: 9 ILKFFLFKCI-FVVIIGILCMGILYLPNDRNNKVSSIKSSEKYQRKLY 55 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,879,887 Number of Sequences: 1657284 Number of extensions: 1642271 Number of successful extensions: 4646 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4646 length of database: 575,637,011 effective HSP length: 79 effective length of database: 444,711,575 effective search space used: 10228366225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -