BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30566 (860 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 3.0 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 9.0 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.0 bits (52), Expect = 3.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 195 FRTFAHWLCFRTNF 154 FR F HWLC + F Sbjct: 845 FRIFCHWLCNHSTF 858 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 9.0 Identities = 15/60 (25%), Positives = 26/60 (43%) Frame = +2 Query: 443 VAHVEYQTEQRHYGHTDCPGXADYIKNMITGTGQMDGAILXAXATDGGNATNTRTFATCQ 622 V++ +Y T Q H H + AD+ + G Q + A+ D + T T +C+ Sbjct: 1274 VSNCKYNTTQHHQTHHERRTTADFGRKATDGR-QHEYAVPSNCLLDTTHETYNTTATSCE 1332 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,019 Number of Sequences: 2352 Number of extensions: 14959 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -