BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30565 (457 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 29 1.4 SB_18509| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_38458| Best HMM Match : MerC (HMM E-Value=5) 27 7.4 >SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) Length = 270 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -3 Query: 359 FLPRNINRLWRCPTKIKLIFSLNGKKVL*SNIIPTHTLNVKTSRTSTCL 213 FL +N WRCP +++IF L L + P T N S+T+T + Sbjct: 48 FLMAELNVSWRCPGALRVIF-LRSLTFLMTQ-YPATTANTTRSKTATVM 94 >SB_18509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.1 bits (57), Expect = 7.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 239 KTSRTSTCLVLSCFKTHFVFIYQEHLLYFIL 147 K SRT +V+ F +H V+I LYFI+ Sbjct: 153 KVSRTMYLIVIILFASHTVYILITPALYFIV 183 >SB_38458| Best HMM Match : MerC (HMM E-Value=5) Length = 110 Score = 27.1 bits (57), Expect = 7.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 239 KTSRTSTCLVLSCFKTHFVFIYQEHLLYFIL 147 K SRT +V+ F +H V+I LYFI+ Sbjct: 47 KVSRTMYLIVIILFASHTVYILITPALYFIV 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,951,528 Number of Sequences: 59808 Number of extensions: 268050 Number of successful extensions: 490 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 920703675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -