BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30564 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) 30 2.1 SB_2520| Best HMM Match : Fer2 (HMM E-Value=5.2) 30 2.1 SB_11639| Best HMM Match : DUF1225 (HMM E-Value=0.71) 28 6.3 SB_3949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 >SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) Length = 1480 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +3 Query: 54 LKYNAFAINANYYRNFRYKPVERDI*NINFQRNNAE*FAKSVNS*KCVYEF 206 +K+ FA YY FR+ E NF + + F K+ N K +Y F Sbjct: 1 MKFTEFAKRYPYYSRFRFSADEHGDVQFNFNGDEYDPFDKNGNLVKTLYRF 51 >SB_2520| Best HMM Match : Fer2 (HMM E-Value=5.2) Length = 453 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +3 Query: 45 SDKLKYNAFAINANYYRNFRYKPVERDI*NINFQRNNAE*FAKSVNS*KCVYEF 206 SD +K+ FA YY FR+ E F + + F K+ N K +Y F Sbjct: 165 SDPMKFTEFAKRYPYYSRFRFSADEHGNVQFVFNGDEYDPFDKNGNLVKTLYHF 218 >SB_11639| Best HMM Match : DUF1225 (HMM E-Value=0.71) Length = 843 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 518 TVDFQTFHSYIELHSLYITSVMILIPFYED 429 TV +FH+ I+ HS ++ ++ L+P + D Sbjct: 578 TVSAASFHANIQSHSSHLPAISTLLPLFPD 607 >SB_3949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = +3 Query: 54 LKYNAFAINANYYRNFRYKPVERDI*NINFQRNNAE*FAKSVNS*KCVYEF 206 +K+ F YY FR+ E NF + + F K+ N K +Y F Sbjct: 1 MKFTEFVKRYPYYSRFRFSADEHGDVQFNFNGDEYDPFDKNGNLVKTLYRF 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,941,663 Number of Sequences: 59808 Number of extensions: 378174 Number of successful extensions: 620 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -