BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30564 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08310.1 68418.m00978 pentatricopeptide (PPR) repeat-containi... 30 1.7 At4g38750.1 68417.m05488 expressed protein 28 6.8 >At5g08310.1 68418.m00978 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1280 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +2 Query: 344 LIMLLGLYKDIKKRSNLTPDAGISDASTCLHKMESKSSR 460 L M L LY +IK RS + PD GI C ES+ SR Sbjct: 334 LEMALSLYLEIK-RSGIPPDRGILGKLLCSFSEESELSR 371 >At4g38750.1 68417.m05488 expressed protein Length = 1073 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 272 LGFVSNINISMICLNRLQFKVLFGLIMLLGLYKD-IKKRSNLTP 400 L ++ N SM+ L+ Q VL LI +L LY+D I N TP Sbjct: 418 LNYMQRAN-SMVLLSTSQLSVLHALISVLILYEDNISVHLNATP 460 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,110,033 Number of Sequences: 28952 Number of extensions: 275381 Number of successful extensions: 530 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -