BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30552 (410 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12334| Best HMM Match : 7tm_1 (HMM E-Value=0.35) 28 2.6 >SB_12334| Best HMM Match : 7tm_1 (HMM E-Value=0.35) Length = 311 Score = 28.3 bits (60), Expect = 2.6 Identities = 24/107 (22%), Positives = 44/107 (41%), Gaps = 4/107 (3%) Frame = -1 Query: 317 FFGNLCS-LIYVALGHHSQQMVRIGFNDVSGTTAPSTTLSRPARSTSTESNEQSQYXXXX 141 F ++C+ IY+A Q +++ D GT+ P S R ST + QY Sbjct: 130 FVSSMCNPFIYMARCKRFNQALKLLCKDPLGTSEPRENASYNKRPLSTSACSSIQYSNKS 189 Query: 140 XXXXX*NYH*SYIKRLKT*NRNRFNN---IDTNIDSQLKHIQLSNAN 9 + S ++ N++ +N + T+ S ++H+ S N Sbjct: 190 FTSNERSLSKSASSSIQYSNKSFTSNERPLSTSASSSIQHLNKSLTN 236 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,169,606 Number of Sequences: 59808 Number of extensions: 191015 Number of successful extensions: 404 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -