BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30543 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58812| Best HMM Match : Paramecium_SA (HMM E-Value=3.4) 30 1.4 SB_1137| Best HMM Match : CC (HMM E-Value=2) 28 5.6 SB_15990| Best HMM Match : zf-CCCH (HMM E-Value=4.1) 28 7.4 SB_21375| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_58812| Best HMM Match : Paramecium_SA (HMM E-Value=3.4) Length = 327 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 133 VFRFVHGVPSHSFLIISKCYI*LINIQYCSVILYAYLTPNCIPRKT 270 V +++ VPS + + K Y+ + + C+ ++ +YL NC+P KT Sbjct: 50 VISYLNCVPSKTCTAMVKSYLNCVPSKTCTAMVISYL--NCVPSKT 93 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 133 VFRFVHGVPSHSFLIISKCYI*LINIQYCSVILYAYLTPNCIPRKT 270 V +++ VPS + + K Y+ + + C+ ++ +YL NC+P KT Sbjct: 242 VISYLNCVPSKTCTAMVKSYLNCVPSKTCTAMVISYL--NCVPSKT 285 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +1 Query: 142 FVHGVPSHSFLIISKCYI*LINIQYCSVILYAYLTPNCIPRKT 270 +++ VPS + + K Y+ + + C+ ++ +YL NC+P KT Sbjct: 5 YLNCVPSKTCTAMVKSYLNCVPFKTCTAMVISYL--NCVPSKT 45 >SB_1137| Best HMM Match : CC (HMM E-Value=2) Length = 410 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 171 ERMRRYPVYKTKHLEHYPTYSKH 103 E R Y YK KH +HY T+++H Sbjct: 309 ELARLYHEYKAKHGKHYRTHAEH 331 >SB_15990| Best HMM Match : zf-CCCH (HMM E-Value=4.1) Length = 236 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 159 RYPVYKTKHLEHYPTYSKHATC 94 RY + T+H H Y+ HATC Sbjct: 149 RYMSHATRHTLHVTRYTSHATC 170 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 159 RYPVYKTKHLEHYPTYSKHATCIYLDYS 76 RY + T+H H Y HATC L S Sbjct: 209 RYTSHATRHTLHVTRYMSHATCHTLHVS 236 >SB_21375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 183 TYY*ERMRRYPVYKTKHLEHYPTYSKHATC 94 T+Y + RY + T++ H Y+ H TC Sbjct: 33 THYTRHVTRYTGHVTRYTRHAIRYTNHVTC 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,958,520 Number of Sequences: 59808 Number of extensions: 342209 Number of successful extensions: 564 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -