BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30538 (488 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 2.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.0 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 7.9 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 7.9 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 142 WVCPCDGGSRSINHQDFYYLPFYS 71 W+C + S ++FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 132 LATEDRGR*IIRTFIICHFIQNLLLESKNY 43 LA + + ++ T + F+QNL+L+ Y Sbjct: 149 LAVKTTSKSLVPTPVTHIFLQNLILKENTY 178 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +2 Query: 407 NECTYCQLMIQLRVLLAIYSKY 472 N C YC + VL I+ Y Sbjct: 471 NSCQYCNIAFGDAVLYTIHMGY 492 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 445 PQLNHQLAVCALVFHISLKDTELW 374 P++ H+L A V+ I + E W Sbjct: 606 PKMRHELQKLAQVYRILGETIETW 629 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,880 Number of Sequences: 336 Number of extensions: 2300 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -