BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30524 (565 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) 280 6e-76 SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) 124 4e-29 SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) 102 2e-22 SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 9e-22 SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) 61 7e-10 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 54 8e-08 SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) 44 9e-05 SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 29 2.6 SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) 29 3.5 SB_42654| Best HMM Match : Tfb4 (HMM E-Value=0.0028) 29 3.5 SB_9853| Best HMM Match : Lipase_3 (HMM E-Value=0.00075) 27 8.0 SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) 27 8.0 >SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) Length = 293 Score = 280 bits (686), Expect = 6e-76 Identities = 125/141 (88%), Positives = 136/141 (96%) Frame = +2 Query: 143 DTDELNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAPLKIC 322 + ++LN+D++I +LL+VRG +PG NVQLTE EI+GLCLKSREIFLSQPILLELEAPLKIC Sbjct: 3 EPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKIC 62 Query: 323 GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 502 GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR Sbjct: 63 GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 122 Query: 503 GNHECASINRIYGFYDECKKR 565 GNHECASINRIYGFYDECK+R Sbjct: 123 GNHECASINRIYGFYDECKRR 143 >SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) Length = 173 Score = 124 bits (300), Expect = 4e-29 Identities = 55/114 (48%), Positives = 76/114 (66%) Frame = +2 Query: 224 LTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLF 403 L E ++K LC E+ L + + + +P+ +CGDIHGQ+YDL LF GG P ++Y+F Sbjct: 17 LPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVF 76 Query: 404 LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKKR 565 +GD+VDRG SLET LL K K+P+ LLRGNHE I ++YGFYDEC+ + Sbjct: 77 MGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSK 130 >SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 116 bits (278), Expect = 2e-26 Identities = 54/93 (58%), Positives = 71/93 (76%) Frame = +2 Query: 155 LNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIH 334 L++DNVI++LL + + PG VQL E +I+ +C SREIFL QP+LLE+ AP+ I GDIH Sbjct: 10 LDVDNVIEQLLSYK-KNPGKQVQLPEAQIRQICQVSREIFLQQPMLLEIGAPINIFGDIH 68 Query: 335 GQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQ 433 GQY DLLR F+ G+PP +Y+FLGDYVDR K+ Sbjct: 69 GQYEDLLRHFDKLGYPPNESYIFLGDYVDRPKR 101 >SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) Length = 199 Score = 102 bits (244), Expect = 2e-22 Identities = 42/83 (50%), Positives = 62/83 (74%) Frame = +2 Query: 221 QLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYL 400 QLTE ++K LC K++EI + + E++ P+ +CGD+HGQ++DL+ LF GG P++NYL Sbjct: 23 QLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYL 82 Query: 401 FLGDYVDRGKQSLETICLLLAYK 469 F+GDYVDRG S+ET+ LL+ K Sbjct: 83 FMGDYVDRGYYSVETVTLLVTLK 105 >SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 100 bits (239), Expect = 9e-22 Identities = 48/95 (50%), Positives = 61/95 (64%) Frame = +2 Query: 269 IFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI 448 I + +LE++AP+ +CGDIHGQ+YDL++LFE GG P + YLFLGDYVDRG S+E Sbjct: 69 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIE-- 126 Query: 449 CLLLAYKIKYPENFFLLRGNHECASINRIYGFYDE 553 CL Y FLLRGNHEC + + F E Sbjct: 127 CL-------YTNTLFLLRGNHECRHLTEYFTFKTE 154 >SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) Length = 720 Score = 60.9 bits (141), Expect = 7e-10 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +2 Query: 248 LCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL----RLFEYGGFPPESNYLFLGDY 415 +C RE+ + +P +L +++P+ + GD+HG + DL+ L+ G SN+LFLGDY Sbjct: 652 VCRSLREVVMEEPRMLRVQSPVYVLGDLHGNFRDLVCFEKLLWRMGPVLTPSNFLFLGDY 711 Query: 416 VDRGKQSLE 442 VDRG+ +E Sbjct: 712 VDRGENGVE 720 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 54.0 bits (124), Expect = 8e-08 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +2 Query: 374 GFP-PESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE 514 G P PE+ Y+F GD VDRG +S+E +L A+ I YP ++ RGNHE Sbjct: 2 GLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHE 49 >SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) Length = 250 Score = 44.0 bits (99), Expect = 9e-05 Identities = 24/66 (36%), Positives = 34/66 (51%) Frame = +2 Query: 317 ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 496 + GDIHG L +LFE +FLGDYVD +S TI L+ +I + Sbjct: 7 VFGDIHGGLRALQQLFERAEITINDKLIFLGDYVDGWSESAATIQFLI--EIAEKHDCIF 64 Query: 497 LRGNHE 514 ++GNH+ Sbjct: 65 IKGNHD 70 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 29.1 bits (62), Expect = 2.6 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 7/105 (6%) Frame = +2 Query: 74 SLFFYLFYSTIFRTHTIYPMADRDTDELNIDNVIKKLLKVRGEKPGMNVQLTEIEI---- 241 SLF LF + H Y +AD+ T ++N + V L + G+ ++ T I + Sbjct: 443 SLFSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNL----DPDGVFIRSTRIRVARNL 498 Query: 242 KGLCLKSREIFLSQPILLELEAPLKIC---GDIHGQYYDLLRLFE 367 KG L + + + +E + +C GD+ G+YY L + E Sbjct: 499 KGYAL-TPGLTRKERNEIEKKVTEVLCSLTGDLAGKYYPLTGMDE 542 >SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) Length = 493 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 419 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECA-SINRIYGFYDECKKR 565 D KQS T+C+LL Y+ KY E + + N EC+ + N Y K R Sbjct: 444 DTTKQSRRTVCMLL-YRAKYIEGCY-ISVNTECSITCNLFRHLYSYPKSR 491 >SB_42654| Best HMM Match : Tfb4 (HMM E-Value=0.0028) Length = 128 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 458 GAGILFPRTACHGPHSLQGRDSWTPEGSHHTQTTLR 351 G+ L+P+ +C G SL +DS + S T LR Sbjct: 67 GSKFLYPKASCEGIQSLPSQDSKYEKFSEFNDTVLR 102 >SB_9853| Best HMM Match : Lipase_3 (HMM E-Value=0.00075) Length = 593 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 221 EHSYQASHLVLLVIFLLRYRCLTHLCLCLPSDILYVYEI 105 E + ASHL+L VIFL + LT +C + ++ +E+ Sbjct: 49 ESLFTASHLILSVIFLFFF--LTAICFSITCNLDLAFEM 85 >SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 287 ILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNY 397 +L+E+ LK GD+ + R+ EY G PE Y Sbjct: 1414 MLIEVPYFLKAFGDVQSTMTSVQRILEYCGLKPELAY 1450 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,672,892 Number of Sequences: 59808 Number of extensions: 372743 Number of successful extensions: 1081 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1076 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -