BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30480 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 31 0.60 At2g19110.1 68415.m02231 ATPase E1-E2 type family protein / halo... 28 5.6 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 31.5 bits (68), Expect = 0.60 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +3 Query: 417 IALEHLNKTMVSWK-TIVYSNNLIQNTCH*NSRWLFFNTSSYLIL 548 I + + + +V K T+VY++NL+QN C+ W+ ++ + +++ Sbjct: 286 IGYDQIRRFIVDNKATMVYNSNLVQNYCYAKKTWIGYDDNQSIVM 330 >At2g19110.1 68415.m02231 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein / heavy-metal-associated domain-containing protein similar to cadmium efflux pump protein from Geobacillus stearothermophilus [GI:16753175], cadmium resistance protein B from Staphylococcus aureus [GI:14020985]; T20K24.13 has been merged with T20K24.12 per suggestion of Dr. Kristian Axelsen (axe@biobase.dk) Length = 1172 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 79 ARGHFTHLCTRSYIKRLTSRRSPRAHAHTH 168 A+ H C RSY K L S R H H H Sbjct: 1138 AKRHSGKSCCRSYAKELCSHRHHHHHHHHH 1167 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,130,560 Number of Sequences: 28952 Number of extensions: 309207 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -