SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP08_F_I22
         (655 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    24   1.5  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   7.9  

>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 14/58 (24%), Positives = 22/58 (37%), Gaps = 1/58 (1%)
 Frame = +3

Query: 36  RSKVSXFKC*LNHASTR-KISKPSTSASKESCSPAK*CTSSCGSIDPGYDSSSTSAAL 206
           RS  S  +C +     +  +S PST      C+  +   S C      Y +  T + L
Sbjct: 324 RSPESNSRCSVKREKIKISVSYPSTETLNTKCNTLERTPSKCSQTSVHYSNGQTHSQL 381


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 156 TSWYITWRGSSS 121
           T+WY+ W+G  S
Sbjct: 672 TNWYMGWKGMLS 683


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,292
Number of Sequences: 438
Number of extensions: 2873
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -