SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP08_F_E22
         (654 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   6.0  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   6.0  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    21   7.9  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    21   7.9  

>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/30 (33%), Positives = 13/30 (43%)
 Frame = -2

Query: 302 VFKGAISIITGTEHLTYPIFEWIHFKFWIC 213
           VF   I      ++LTY    W H   W+C
Sbjct: 506 VFTFNIIKFVPVKYLTYEYPWWSHVLGWLC 535


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/30 (33%), Positives = 13/30 (43%)
 Frame = -2

Query: 302 VFKGAISIITGTEHLTYPIFEWIHFKFWIC 213
           VF   I      ++LTY    W H   W+C
Sbjct: 559 VFTFNIIKFVPVKYLTYEYPWWSHVLGWLC 588


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 191 ITYGQSAHISRT 226
           +TYGQ+ HIS T
Sbjct: 64  LTYGQTNHISLT 75


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 191 ITYGQSAHISRT 226
           +TYGQ+ HIS T
Sbjct: 102 LTYGQTNHISLT 113


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,516
Number of Sequences: 438
Number of extensions: 3228
Number of successful extensions: 11
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -