BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_G20 (625 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 103 7e-23 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 102 2e-22 At5g52490.1 68418.m06512 fibrillarin, putative similar to fibril... 86 2e-17 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 103 bits (248), Expect = 7e-23 Identities = 51/76 (67%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +1 Query: 394 QVIIEPHRHPGVFIXRGKXXALVTKNLVPXSXVYGEXXISLDNE-RDKVEYXVWNPFXSK 570 +VI+EPHRH GVFI +GK ALVTKNLVP VY E IS+ NE KVEY VWNPF SK Sbjct: 68 KVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSK 127 Query: 571 LAAAIMGGVDAIHMAP 618 LAAAI+GGVD I + P Sbjct: 128 LAAAILGGVDNIWIKP 143 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 102 bits (244), Expect = 2e-22 Identities = 50/76 (65%), Positives = 56/76 (73%), Gaps = 1/76 (1%) Frame = +1 Query: 394 QVIIEPHRHPGVFIXRGKXXALVTKNLVPXSXVYGEXXISLDNE-RDKVEYXVWNPFXSK 570 +VI+EPHRH GVFI +GK ALVTKNLVP VY E IS+ NE K EY VWNPF SK Sbjct: 79 KVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKTEYRVWNPFRSK 138 Query: 571 LAAAIMGGVDAIHMAP 618 LAAAI+GGVD I + P Sbjct: 139 LAAAILGGVDNIWIKP 154 >At5g52490.1 68418.m06512 fibrillarin, putative similar to fibrillarin from {Xenopus laevis} SP|P22232, {Mus musculus} SP|P35550, {Homo sapiens} SP|P22087 Length = 292 Score = 86.2 bits (204), Expect = 2e-17 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = +1 Query: 394 QVIIEPHRHPGVFIXRGKXXALVTKNLVPXSXVYGEXXISLDNE-RDKVEYXVWNPFXSK 570 +V++ PHRH GVF+ + K ALVTKNLVP +Y E I + NE R VEY VWNP SK Sbjct: 58 KVLVTPHRHAGVFVAKSKADALVTKNLVPGEIIYNEKRIFVQNEDRSTVEYRVWNPHRSK 117 Query: 571 LAAAIMGGVDAIHMAP 618 LA AI GVD I + P Sbjct: 118 LADAITTGVDNIWIKP 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,587,572 Number of Sequences: 28952 Number of extensions: 86056 Number of successful extensions: 160 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -