BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F22 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06360.1 68418.m00712 ribosomal protein S8e family protein co... 234 4e-62 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 31 0.51 At5g22640.1 68418.m02645 MORN (Membrane Occupation and Recogniti... 30 1.2 At3g59140.1 68416.m06593 ABC transporter family protein putative... 30 1.2 At1g16210.1 68414.m01941 expressed protein ESTs gb|T04357 and gb... 30 1.2 At4g35870.1 68417.m05094 expressed protein 29 2.7 At3g28770.1 68416.m03591 expressed protein 29 2.7 At2g42610.2 68415.m05274 expressed protein contains Pfam profile... 29 2.7 At2g42610.1 68415.m05273 expressed protein contains Pfam profile... 29 2.7 At1g65710.1 68414.m07458 expressed protein ; expression supporte... 29 2.7 At2g41460.1 68415.m05122 apurinic endonuclease-redox protein / D... 29 3.6 At1g76890.2 68414.m08948 trihelix DNA-binding protein / GT-2 fac... 29 3.6 At1g76890.1 68414.m08947 trihelix DNA-binding protein / GT-2 fac... 29 3.6 At5g25410.1 68418.m03014 expressed protein contains Pfam profil... 28 4.7 At2g22795.1 68415.m02704 expressed protein 28 4.7 At5g41550.1 68418.m05049 disease resistance protein (TIR-NBS-LRR... 28 6.2 At2g40950.1 68415.m05056 bZIP transcription factor family protei... 28 6.2 At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family pr... 27 8.2 At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family pr... 27 8.2 At3g09850.1 68416.m01175 D111/G-patch domain-containing protein ... 27 8.2 At1g76220.1 68414.m08851 hypothetical protein contains Pfam prof... 27 8.2 At1g49610.1 68414.m05562 F-box family protein contains F-box dom... 27 8.2 >At5g06360.1 68418.m00712 ribosomal protein S8e family protein contains Pfam profile PF01201: Ribosomal protein S8e Length = 260 Score = 234 bits (572), Expect = 4e-62 Identities = 115/200 (57%), Positives = 137/200 (68%), Gaps = 1/200 (0%) Frame = +1 Query: 55 MPQNEYIERHQKLYGRRLDYXXXXXXXXXXXXXXXXXXXXXLRGIKAKIFNKERRNEKIQ 234 MPQ +YI+ H+K G RLD+ GIK K+ K+ EK Sbjct: 1 MPQGDYIDLHRKRNGYRLDHFERKRKKEAREVHKHSTMAQKSLGIKGKMIAKKNYAEKAL 60 Query: 235 MKKKIKAHEEKNVKQNT-EKVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 411 MKK +K HEE + ++ E V EGA+P YLLDR+ +RAKVLSN IKQKRKEKAGKW+VP Sbjct: 61 MKKTLKMHEESSSRRKADENVQEGAVPAYLLDREDTTRAKVLSNTIKQKRKEKAGKWEVP 120 Query: 412 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 591 +PKVR A+ E+F+V++SGK K K WKRMVTK TFVG FTRKPPK+ERFIRP LRF K Sbjct: 121 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTK 180 Query: 592 AHVTHPELKATFCLPIIGVK 651 AHVTHPELK TFCL IIG+K Sbjct: 181 AHVTHPELKCTFCLEIIGIK 200 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +1 Query: 349 KVLSNMIKQKRKEKAGKWDVPIPKVRAQADAEVFKVLKSG 468 +VL + ++ K KE+ W+ +P ++++ D EV KVLK G Sbjct: 386 RVLGSFMRGKGKEE---WEFSLPTLKSRLDGEVEKVLKVG 422 >At5g22640.1 68418.m02645 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein contains Pfam profile PF02493: MORN repeat Length = 871 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = +1 Query: 232 QMKKKIKAHEEKNVKQNTEKVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKE 387 ++KKK + E+K TE+ + +PVY ++ V ++ K+ N ++K K+ Sbjct: 632 ELKKKEQEEEKKTEMGLTEEDEDVLVPVYKEEKVVTAKEKIQENKQEEKYKD 683 >At3g59140.1 68416.m06593 ABC transporter family protein putative multi resistance protein mrp - Arabidopsis thaliana, EMBL:ATMRPPROT Length = 1453 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 247 IKAHEEKNVKQNTEKVAEGALPVYLLDRDVQSRAKVL--SNMIKQKRKEK 390 + AH E + V PV ++R + S++KVL S +IKQ+ +EK Sbjct: 823 VNAHRETAGSERVVAVENPTKPVKEINRVISSQSKVLKPSRLIKQEEREK 872 >At1g16210.1 68414.m01941 expressed protein ESTs gb|T04357 and gb|AA595092 come from this gene Length = 234 Score = 30.3 bits (65), Expect = 1.2 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 9/102 (8%) Frame = +1 Query: 205 NKERRNEKIQMKKKIKAHEEKNVK---QNTEKVAEGALPVYLLDRDVQSRAKVLSNMIKQ 375 +++ R ++ Q ++ + + K VK + EK AE A R + K L +K+ Sbjct: 27 DRQTREKEEQYWREAEGPKSKAVKKREEEAEKKAETAAKKLEAKRLAEQEEKELEKALKK 86 Query: 376 KRKEKAGKWDVPIPKV------RAQADAEVFKVLKSGKSKRK 483 K KA + VP+PKV R + + +V K+ SK+K Sbjct: 87 PDK-KANRVTVPVPKVTEAELIRRREEDQVALAKKAEDSKKK 127 >At4g35870.1 68417.m05094 expressed protein Length = 817 Score = 29.1 bits (62), Expect = 2.7 Identities = 22/101 (21%), Positives = 53/101 (52%), Gaps = 1/101 (0%) Frame = +1 Query: 220 NEKIQMKKKIKAHEEKNVKQNTEKVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGK 399 +EK++ ++++A E + E A+GA +++ +DV + K + + + +R + GK Sbjct: 312 DEKLRKLQELRADLESQLAAYKEGRAQGAGVAFVMFKDVYTANKAVQD-FRNERSRRTGK 370 Query: 400 WDVPIPKVRAQADAEVFKVLKSGKSKRKAWKRM-VTKVTFV 519 + + ++R Q + +KV ++ + W + +TKV + Sbjct: 371 F-FSVTELRLQRNQ--WKVDRAPLATDIYWNHLGLTKVALI 408 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = +1 Query: 190 KAKIFNKERRNEKIQMKKK---IKAHEEKNVKQNTE 288 K ++ KE+++ K Q KKK +K EEK +K+N E Sbjct: 1175 KNEVDKKEKKSSKDQQKKKEKEMKESEEKKLKKNEE 1210 >At2g42610.2 68415.m05274 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 177 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 253 AHEEKNVKQNTEKVAEGALPVYLLD-RDVQSRAKVLSNMIKQKRK 384 A+EE T A GA+ VYL + R+ Q++A+ + K+K+K Sbjct: 111 AYEENGGPPETNPFASGAIRVYLREVRECQAKARGIPYKKKKKKK 155 >At2g42610.1 68415.m05273 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 177 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 253 AHEEKNVKQNTEKVAEGALPVYLLD-RDVQSRAKVLSNMIKQKRK 384 A+EE T A GA+ VYL + R+ Q++A+ + K+K+K Sbjct: 111 AYEENGGPPETNPFASGAIRVYLREVRECQAKARGIPYKKKKKKK 155 >At1g65710.1 68414.m07458 expressed protein ; expression supported by MPSS Length = 455 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/42 (28%), Positives = 26/42 (61%) Frame = +1 Query: 190 KAKIFNKERRNEKIQMKKKIKAHEEKNVKQNTEKVAEGALPV 315 K++ N+E E++ + K ++HEE++ K ++K + + PV Sbjct: 40 KSEKLNQEEEEEEVVVIKHTRSHEERSKKTESDKDSPVSSPV 81 >At2g41460.1 68415.m05122 apurinic endonuclease-redox protein / DNA-(apurinic or apyrimidinic site) lyase identical to apurinic endonuclease-redox protein SP: P45951 from [Arabidopsis thaliana] Length = 536 Score = 28.7 bits (61), Expect = 3.6 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 6/108 (5%) Frame = +1 Query: 187 IKAKIFNKERRNEKIQMKKKIK--AHEEKNVKQNTEKVAEGALPVYLLDRDVQSRAKVLS 360 IK KI N+E E + H EK VKQ+TEK + + + ++ +S + Sbjct: 152 IKRKISNREEPTEDECTNSEAYDIEHGEKRVKQSTEKNLKAKVSAKAIAKEQKSLMRTGK 211 Query: 361 NMIKQKRKEKAGKWDVPIPK----VRAQADAEVFKVLKSGKSKRKAWK 492 I Q ++E + + K + + + +E + VL + K +K WK Sbjct: 212 QQI-QSKEETSSTISSELLKTEEIISSPSQSEPWTVL-AHKKPQKDWK 257 >At1g76890.2 68414.m08948 trihelix DNA-binding protein / GT-2 factor (GT2) identical to GT2 factor [Arabidopsis thaliana] GI:416490, GI:2664202 (DNA binding factor GT-2 from Arabidopsis) Length = 575 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 427 AQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 591 A + E +KS + KRK WK + TK+T E ++ +RF+ + R K+ Sbjct: 241 ASDEEEDHHQVKSSRKKRKYWKGLFTKLT--KELMEKQEKMQKRFLETLEYREKE 293 >At1g76890.1 68414.m08947 trihelix DNA-binding protein / GT-2 factor (GT2) identical to GT2 factor [Arabidopsis thaliana] GI:416490, GI:2664202 (DNA binding factor GT-2 from Arabidopsis) Length = 498 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 427 AQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 591 A + E +KS + KRK WK + TK+T E ++ +RF+ + R K+ Sbjct: 164 ASDEEEDHHQVKSSRKKRKYWKGLFTKLT--KELMEKQEKMQKRFLETLEYREKE 216 >At5g25410.1 68418.m03014 expressed protein contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 369 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 217 RNEKIQMKKKIKAHEEKNVKQNTE 288 +N KIQMK + HE +N NT+ Sbjct: 60 KNHKIQMKPSVSRHELRNQTDNTK 83 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 28.3 bits (60), Expect = 4.7 Identities = 25/115 (21%), Positives = 49/115 (42%), Gaps = 1/115 (0%) Frame = +1 Query: 208 KERRNEKIQMKKKIKAH-EEKNVKQNTEKVAEGALPVYLLDRDVQSRAKVLSNMIKQKRK 384 +E +++ + K+K+++ +EKN + TEK+ L D + S+ K + K Sbjct: 464 EETMDKETEAKEKVESSSQEKNEDKETEKIESSFLEETKEKEDETKEKEESSSQEKTEEK 523 Query: 385 EKAGKWDVPIPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPK 549 E K + D E K+ K S ++ K T+ E+ +++ K Sbjct: 524 ETETKDNEESSSQEETKDKENEKIEKEEASSQEESKENETETKEKEESSSQEETK 578 >At5g41550.1 68418.m05049 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1085 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 379 RKEKAGKWDVPIPKVRAQADAEVFKVLKSG 468 R E +W++ +P++ A D ++ +LK G Sbjct: 396 RGESKHEWELQLPRIEASLDGKIESILKVG 425 >At2g40950.1 68415.m05056 bZIP transcription factor family protein similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 406 VPIPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVG 522 +PIP+++ Q K KS K +A + V ++F+G Sbjct: 334 IPIPRLKPQNTLGTSKAKKSESKKSEAKTKKVASISFLG 372 >At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 302 Score = 27.5 bits (58), Expect = 8.2 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = +1 Query: 211 ERRNEKIQMKKKIKAHEE-------KNVKQNTEKVAEGALPVYLLDRDVQSRAKVLSNMI 369 E + EK + KKKIKA +E K+ NTE +E P Y+ R + A ++ Sbjct: 97 EGKTEKRE-KKKIKAEDETEPSMKGKSNMSNTETSSEIQKPDYIHVRARRGEATDRHSLA 155 Query: 370 KQKRKEKAGK 399 ++ R+EK K Sbjct: 156 ERARREKISK 165 >At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 304 Score = 27.5 bits (58), Expect = 8.2 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = +1 Query: 211 ERRNEKIQMKKKIKAHEE-------KNVKQNTEKVAEGALPVYLLDRDVQSRAKVLSNMI 369 E + EK + KKKIKA +E K+ NTE +E P Y+ R + A ++ Sbjct: 97 EGKTEKRE-KKKIKAEDETEPSMKGKSNMSNTETSSEIQKPDYIHVRARRGEATDRHSLA 155 Query: 370 KQKRKEKAGK 399 ++ R+EK K Sbjct: 156 ERARREKISK 165 >At3g09850.1 68416.m01175 D111/G-patch domain-containing protein contains Pfam profile PF01585: G-patch domain Length = 781 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +1 Query: 184 GIKAKIFNKERRNEKIQMKKKIKAHEEKNVKQNTEKVAEGALPV-YLLDRDVQSRAKVLS 360 G+K K + +R+ K KK+ E + K N +K + PV ++ + S V Sbjct: 546 GVKGKSGSLDRKKAKDSAKKRPTREERERNKSNGKKSSYADQPVSFVSSGIIDSEIAVAK 605 Query: 361 NMIKQKRKEKA 393 +++ KE A Sbjct: 606 TSVEKVAKEVA 616 >At1g76220.1 68414.m08851 hypothetical protein contains Pfam profile PF03087: Arabidopsis protein of unknown function Length = 256 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +1 Query: 181 RGIKAKIFNKERRNEKIQMKKKIKAHEEKNVKQNTEKVAE 300 RGI ++IFNK +N+++ + + K E ++ + TEK E Sbjct: 200 RGIVSRIFNK--KNQEVDVDELKKLRETEHEIEETEKELE 237 >At1g49610.1 68414.m05562 F-box family protein contains F-box domain Pfam:PF00646 Length = 354 Score = 27.5 bits (58), Expect = 8.2 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = -2 Query: 533 VKFSPT-NVTLVTMRFQAFLFDLPDFRTLNTSASAWALT-LGMGTSHFPAFSLRFCFIML 360 +KF+ + NV + + F L+D+PD+ +N+S ++ + G + +L FC Sbjct: 113 IKFAMSRNVENLFLSFDFRLYDVPDYLYINSSVKQLSIAKILSGCPIIESLTLHFC---- 168 Query: 359 DNTLALD*TSLSS 321 D + LD T S Sbjct: 169 DQLMVLDLTKSPS 181 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,037,558 Number of Sequences: 28952 Number of extensions: 219254 Number of successful extensions: 810 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -