BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_F21 (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 83 1e-16 At3g05540.1 68416.m00607 translationally controlled tumor family... 77 9e-15 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 34 0.061 At2g26470.1 68415.m03176 expressed protein contains PF02586: Unc... 29 1.7 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 28 4.0 At4g13440.1 68417.m02097 calcium-binding EF hand family protein ... 28 4.0 At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 28 4.0 At1g76380.3 68414.m08876 DNA-binding bromodomain-containing prot... 28 5.3 At1g76380.1 68414.m08874 DNA-binding bromodomain-containing prot... 28 5.3 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 28 5.3 At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V)... 27 7.0 At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH... 27 7.0 At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, c... 27 7.0 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 83.0 bits (196), Expect = 1e-16 Identities = 54/136 (39%), Positives = 70/136 (51%), Gaps = 2/136 (1%) Frame = +1 Query: 181 W*REHRADIQIEGFNPSAEEA--DEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLK 354 W D+ I G NPSAEE DEG D + + VDIV RL E + DKK + Y+K Sbjct: 35 WVTVGAVDVNI-GANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTY-DKKGFIAYIK 92 Query: 355 DYMKKLVXKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYTD 534 Y+K L KL E+ DQ VFK + K +L R + QFF GE M D + Y Sbjct: 93 KYIKLLTPKLSEE--DQA-VFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYK- 148 Query: 535 FDGTQIPIMMFFKHGL 582 +G+ P ++F HGL Sbjct: 149 -EGSTNPTFLYFAHGL 163 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/37 (40%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +3 Query: 81 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVT 188 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVT 37 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 77.0 bits (181), Expect = 9e-15 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 3/128 (2%) Frame = +1 Query: 208 QIEGFNPSAEEA--DEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 381 ++EG NPS EE DEG D VDI+ RL E +F DKK + +++K Y+K+L K Sbjct: 30 EVEGKNPSGEEGGEDEGVDDQAVKVVDIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPK 88 Query: 382 LEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDC-DGMVAMMEYTDFDGTQIPI 558 L+ + E+FK ++ K ++ + K+ QFF GESM+ +G + Y +G P Sbjct: 89 LDS---ENQELFKKHIESATKFLMSKLKDFQFFVGESMEGEEGSLVFAYYR--EGATDPT 143 Query: 559 MMFFKHGL 582 ++ +GL Sbjct: 144 FLYLAYGL 151 Score = 36.3 bits (80), Expect = 0.015 Identities = 15/41 (36%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +3 Query: 81 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQG 200 M +Y+DI+TGDE+ SD++ K ++ +++EV G+ + +G Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIENGMLWEVEGKNPSGEEG 41 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 34.3 bits (75), Expect = 0.061 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +1 Query: 250 GTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLK-------DYMKKLVXKLEEKAPDQV 408 G D +SG++ + + + Y G+ + +LY + D M+ + KL P + Sbjct: 184 GIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIM 243 Query: 409 EVFKTNMNKVMKDILGRFKELQ-FFTGESMD 498 EVFK+N N + ++ F ++ FF GE D Sbjct: 244 EVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At2g26470.1 68415.m03176 expressed protein contains PF02586: Uncharacterized ACR, COG2135; weak similarity to NF-M protein (GI:205688) [Rattus norvegicus] Length = 487 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 119 HLITSDNVLIDLHFDGLEAIKNNKNRKNGFSPQTTKPG 6 H T+D L LH + +E I N+N+K + TTK G Sbjct: 384 HFFTADERLNQLH-EAVEDIPGNENQKTVLTSPTTKEG 420 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 214 EGFNPSAEEADEGTDSAVESG 276 EGF P+AEEAD+G S + G Sbjct: 272 EGFLPTAEEADDGIGSMMMGG 292 >At4g13440.1 68417.m02097 calcium-binding EF hand family protein low similarity to Polcalcin (Calcium-binding pollen allergen) from {Phleum pratense} SP|O82040, {Cynodon dactylon} SP|P94092; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 154 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 472 QFFTGESMDCDGMVAMMEYTDF 537 QFF ++ DG V++ EYTDF Sbjct: 25 QFFRAMDVNGDGRVSLQEYTDF 46 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 315 VCFD*PVVQDYVNSALDGRVRALVSLFSRRIKTLDLDISPVLSS 184 V F P+V ++AL+ +R L LF + T+DL + V SS Sbjct: 369 VAFPIPIVLPMQSTALEAEIRHLHRLFGSLLTTMDLCMCRVESS 412 >At1g76380.3 68414.m08876 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 579 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/83 (25%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +1 Query: 202 DIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 381 D+ + N + + T DI+L LVE+ DKK L KK Sbjct: 104 DLDSDARNRRKIDGSDNTGEKASKATDILLQRSLVESTPLPDKKLLFFILDRVQKKDTYG 163 Query: 382 L------EEKAPDQVEVFKTNMN 432 + E+ PD E+ K M+ Sbjct: 164 VYSDPADPEELPDYYEIIKNPMD 186 >At1g76380.1 68414.m08874 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 579 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/83 (25%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +1 Query: 202 DIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVXK 381 D+ + N + + T DI+L LVE+ DKK L KK Sbjct: 104 DLDSDARNRRKIDGSDNTGEKASKATDILLQRSLVESTPLPDKKLLFFILDRVQKKDTYG 163 Query: 382 L------EEKAPDQVEVFKTNMN 432 + E+ PD E+ K M+ Sbjct: 164 VYSDPADPEELPDYYEIIKNPMD 186 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -2 Query: 191 SRHQPTGHFVNNFIDQFHFVGVREHLITSDNVLIDLHFDGLEAIKNNKNRKN 36 SRHQP+ V D E T+ + + +LHFDG N N N Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDGFTDSPNQLNFTN 175 >At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P41972 Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) {Staphylococcus aureus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1093 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 427 MNKVMKDILGRFKELQFFTGE---SMDCDGM 510 +NK++KDI+ R+K LQ + + DC G+ Sbjct: 167 LNKILKDIINRYKLLQNYKVQYVPGWDCHGL 197 >At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH protease GI:13183728 from [Medicago sativa] Length = 704 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 220 FNPSAEEADEG--TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMK 366 F PS E + G + S +E+ + + L R+ E FGD+ T D+M+ Sbjct: 546 FAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQ 596 >At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, chloroplast (FTSH1) (FTSH) identical to SP:Q39102 Cell division protein ftsH homolog 1, chloroplast precursor (EC 3.4.24.-) [Arabidopsis thaliana] Length = 716 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 220 FNPSAEEADEG--TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMK 366 F PS E + G + S +E+ + + L R+ E FGD+ T D+M+ Sbjct: 558 FAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQ 608 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,051,237 Number of Sequences: 28952 Number of extensions: 231331 Number of successful extensions: 656 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -