BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E09 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 159 7e-52 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.80 SB_8510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 2.4 SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) 29 4.2 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 5.6 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 5.6 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 28 7.4 SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) 28 7.4 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 9.8 SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 9.8 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 159 bits (387), Expect(2) = 7e-52 Identities = 78/120 (65%), Positives = 97/120 (80%) Frame = +2 Query: 17 LKLSTMSTKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKS 196 L + T S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+ Sbjct: 2 LAMFTASAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKA 61 Query: 197 IIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 376 III+VP+P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 62 IIIFVPVPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect(2) = 7e-52 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 488 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 589 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.80 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = +2 Query: 119 NSDLKAQLRELYITKAKEIE---LHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-- 283 + + K L+E+ I ++K+ E + + KS PKLKA Q + + KK Sbjct: 261 HEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKP 320 Query: 284 ---GKHVVFVGDRKILPKPSHKTRVANKQKRPRS 376 K V+ LP+ +H+ AN Q+RP++ Sbjct: 321 VKRAKKVLNKKKMDTLPRGAHRPASANAQRRPQN 354 >SB_8510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -1 Query: 573 TSRPVSFLYTDWKVSTLCSIVVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSRIASY 394 T+R ++ ++DW ++ C CW +S T+ S LT +++P + + K A Y Sbjct: 120 TNRCGAYYHSDWLIAIPCRRRACWTVSLITIFS---QVLTNIKVPIPAYSREKGYYTAHY 176 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.5 bits (63), Expect = 2.4 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 5/111 (4%) Frame = +2 Query: 44 IIKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYV 211 ++++SG +S E+ + E N+ LK +L E L +T+ +E E+ N K + +YV Sbjct: 1681 VLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYV 1734 Query: 212 PMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILP-KPSHKTRVANKQ 361 M KL++ Q ELEK+ ++ ++I P K S T VA + Sbjct: 1735 NMSKLESTQGTLEEKNAELEKE------LYSAQQEIQPLKDSFNTAVAENE 1779 >SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) Length = 237 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 358 FVSNTSFVAGLRQDLTVSNKDYMFTTE 278 F+ N SFV+ + DLT S+ D+ + TE Sbjct: 40 FIPNLSFVSAVLWDLTKSSSDFQWHTE 66 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 71 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 238 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 123 PTSKPNFGSFTLQKLKKLNYTIRS 194 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 328 LRQDLTVSNKDYMFTTELLFELTDKPDLDLLKGLQFRHRHIDDDRLL 188 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 170 LRQRLNSSNPSISSPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 216 >SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) Length = 1213 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 602 TNKVRGTRRSLRVPLASCIQTGRCPL 525 TN+ +G+RRS R P S +T R P+ Sbjct: 294 TNETKGSRRSTRNPNQSPAETARTPI 319 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +3 Query: 102 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 200 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 513 VVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSR 406 V+CW L + + + EP N L +L ++ GK K S+ Sbjct: 339 VICWVLGEYSYIVSEP-NTVLEQLHSLLDGKLKDSK 373 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +2 Query: 209 VPMPKLKAFQKIQIRLVRELEKKFSG 286 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.5 bits (58), Expect = 9.8 Identities = 20/101 (19%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Frame = +2 Query: 62 AEADSFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKL 226 A+ + + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 237 AQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKV 296 Query: 227 KAFQKIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHK 340 + + + +RE+E++F K+ + +R++ + K Sbjct: 297 AKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKK 337 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,682,567 Number of Sequences: 59808 Number of extensions: 378452 Number of successful extensions: 1016 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -