BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E04 (512 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 1.2 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.9 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.4 bits (48), Expect = 1.2 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = -3 Query: 276 EPMLVIRSRTLMPSKALANRPGQYGSTXTAAAFKMVEIFSPVTATSSSSQDESRVNT 106 +P VI + T PS L+NR G+ A+ P T+T++ + ++ T Sbjct: 123 KPSGVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPPTTSTTTRTTLTTKFTT 179 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.2 bits (45), Expect = 2.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 140 DVAVTGEKISTILKAAAVXVEPYWPGLFAKAL 235 +V + EKI +L+ P PG FAK L Sbjct: 334 EVEMLREKIYGVLEEYTRTTHPNEPGRFAKLL 365 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 253 TDIDAFQGFGEQTWPI 206 TD+D F+G WP+ Sbjct: 515 TDLDDFKGVCGMKWPL 530 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,916 Number of Sequences: 336 Number of extensions: 1608 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -