BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E04 (512 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 2.6 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.0 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -1 Query: 212 ANMALHXQPPLSRWWKFSHQLRQHHHP 132 A+ LH QP + H HHHP Sbjct: 142 AHHPLHYQPAAAAAMHHHHHHPHHHHP 168 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 8.0 Identities = 12/58 (20%), Positives = 23/58 (39%) Frame = -3 Query: 279 PEPMLVIRSRTLMPSKALANRPGQYGSTXTAAAFKMVEIFSPVTATSSSSQDESRVNT 106 P+P +L+ A N+P T + + ++ P +S D R++T Sbjct: 287 PDPSYYTADASLLHHGAKFNKPAHQTPTSSGIGSRTHPLYQPDHRAEPTSFDFDRIDT 344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,757 Number of Sequences: 2352 Number of extensions: 6346 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -