BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP02_F_E02 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 33 0.15 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 33 0.20 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 33 0.27 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.35 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.35 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.35 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 32 0.35 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 31 0.62 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 31 0.62 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 31 0.62 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 31 0.62 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 31 0.62 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 31 1.1 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 31 1.1 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 30 1.9 SB_2309| Best HMM Match : Fasciclin (HMM E-Value=0) 30 1.9 SB_32863| Best HMM Match : Exo_endo_phos (HMM E-Value=1.2e-06) 29 2.5 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 29 2.5 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 29 3.3 SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 29 4.4 SB_36417| Best HMM Match : MFS_1 (HMM E-Value=0.0037) 29 4.4 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 28 5.8 SB_37309| Best HMM Match : Toxin_29 (HMM E-Value=1.2) 28 5.8 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 28 7.6 SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_50828| Best HMM Match : IspA (HMM E-Value=0.88) 28 7.6 SB_16151| Best HMM Match : CLN3 (HMM E-Value=2.5) 28 7.6 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 36.7 bits (81), Expect = 0.016 Identities = 13/58 (22%), Positives = 29/58 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCEQRLSEYYKIKKS 375 VTC +C++ +++P + + C + L +G +L+C C+ +++ KS Sbjct: 12 VTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQKFWNYVKS 69 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 33.5 bits (73), Expect = 0.15 Identities = 11/63 (17%), Positives = 31/63 (49%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCEQRLSEYYKIKKSYV 381 VTC +C++ +++P + C + L +G +L+C C+ ++ + ++ Sbjct: 13 VTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQKWIQTTSAFR 72 Query: 382 QKQ 390 +++ Sbjct: 73 KRK 75 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC LC++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC LC++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC LC++ +++P + + C + L +G +L+C C+ Sbjct: 133 VTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSEGKGKLVCPLCK 178 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 32.7 bits (71), Expect = 0.27 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHLNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC LC++ +++P + C + L +G +L+C C+ Sbjct: 13 VTCSLCIEHFNDPRVLPCFHSFCRHCLEELAVHSEGKGKLVCPLCK 58 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 31.9 bits (69), Expect = 0.47 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L +G +L+C C+ Sbjct: 18 VTCSICIEHFDDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 63 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + C + L +G +L+C C+ Sbjct: 12 VTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 57 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCEQRL 348 VTC LCLD +++P + K C + LV ++ C C + Sbjct: 14 VTCLLCLDIFTDPRLLPCLHTYCKKCLEDLVSQCQKKGEIYCPQCRHEV 62 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCEQRLS--EYYKIKK 372 +TC +CL+ + +++P K C + + F G L+C TC + S E+ I+K Sbjct: 20 LTCSVCLEQFREPKMLPCFHTFCKECLEKTKQSFRG--NLLCPTCRTKTSVTEHEMIQK 76 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P C + L +G +L+C C+ Sbjct: 13 VTCSICIEHFNDPRVLPCFHSFCLHCLEELAVHSEGRGKLVCPLCK 58 >SB_2309| Best HMM Match : Fasciclin (HMM E-Value=0) Length = 503 Score = 29.9 bits (64), Expect = 1.9 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = -2 Query: 373 ISLSCS-IPKVVAHMS-GILTEVSHQMVPREYQNKI*FVLELLEQFDT 236 ++ CS I KV + S G+L E+S MVP Y N + FV E + F T Sbjct: 48 VTAQCSLITKVNLNASNGVLHELSRVMVPPLYGNIVGFVREQPQHFST 95 >SB_32863| Best HMM Match : Exo_endo_phos (HMM E-Value=1.2e-06) Length = 309 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = -3 Query: 258 NCWNNLILASIIQTKSTCNKQLWIDLYSTHFKDNFFVWVWLVAL 127 N +NL+L S+ +++ N W++L+ + D F W ++A+ Sbjct: 150 NKHSNLLLGSVYGSEAAMNCSDWLELFQSLLSDLSFSWDGMLAI 193 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 VTC +C++ +++P + + C + L E G +L+C C+ Sbjct: 13 VTCAICIEHFTDPRLLPCLHTFCRHCLEDLAE-HSGKGKLVCPLCK 57 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCE 339 V C +C++ +++P + C + L +G +L+C C+ Sbjct: 13 VRCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1867 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 288 NIKTKFNLFLNCWNNLILASIIQTKSTCNKQLWIDLYSTH 169 + + KF LFL W NLIL +++ K+ C DLY H Sbjct: 1565 SFRDKFPLFLMGW-NLILCALLLPKAACGD----DLYGVH 1599 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +1 Query: 433 IQSQQNDVTSSQFNELENEDQITKKHVLKRKRMISSSSSDCDPPVEKKPWKNDSEVCESK 612 +Q +++D + E ENE + KK V + + +IS+S+ K KN++E+ E + Sbjct: 1184 LQKERDDKAEDLY-EKENEVVVMKKRVKEFELLISNSNDSAAKDSLLKTVKNENEIQEKE 1242 >SB_36417| Best HMM Match : MFS_1 (HMM E-Value=0.0037) Length = 547 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 439 SQQNDVTSSQFNEL--ENEDQITKKHVLKRKRMISSSSSDCDPPVEKKPW 582 SQQ D+ SS+F +L ENE +I H + S S + V + W Sbjct: 19 SQQEDICSSEFFDLLSENETEIQTSHTSPVSHLSPSQSISSNKLVPEGGW 68 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 517 KRKRMISSSSSDCDPPVEKKPWKNDSEVC 603 +R+R S SS++C P +E K N+S C Sbjct: 428 RRRRPGSQSSAECSPTLEAKGVMNNSSPC 456 >SB_37309| Best HMM Match : Toxin_29 (HMM E-Value=1.2) Length = 754 Score = 28.3 bits (60), Expect = 5.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 273 FNLFLNCWNNLILASIIQTKSTCNK 199 + F WNN + ++Q+ STC K Sbjct: 280 YQTFFTTWNNKLPVDVLQSDSTCQK 304 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 202 VTCRLCLDDTGQYQIVPTVQEQIKFCFDILVEPFDGLPQLICQTCEQRL 348 VTC LCL+ +++ + + C + L E G + C C +++ Sbjct: 14 VTCCLCLEQYQDPRVLACLHTYCRHCLESLAEHSQG-DSISCPQCREKI 61 >SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +1 Query: 505 KHVLKRKRMISSSSSDCDPPVEKKPWKNDSEVCESKKFGCRLCNCCFT 648 K +L ++ SSS P +K N E C FG C C T Sbjct: 5 KVLLLAALLVVSSSGIKQDPCSEKTCSNQGEECVINSFGMAECRCTST 52 >SB_50828| Best HMM Match : IspA (HMM E-Value=0.88) Length = 245 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 396 ICLFLYIGFLYLVVFRKSLLTCLAY 322 ICL+LY+GF S+LT LA+ Sbjct: 43 ICLYLYVGFFAFFFSGFSVLTTLAF 67 >SB_16151| Best HMM Match : CLN3 (HMM E-Value=2.5) Length = 217 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 396 ICLFLYIGFLYLVVFRKSLLTCLAY 322 ICL+LY+GF S+LT LA+ Sbjct: 26 ICLYLYVGFFAFFFSGFSVLTTLAF 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,995,531 Number of Sequences: 59808 Number of extensions: 330084 Number of successful extensions: 793 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -