BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10j18r (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.9 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 5.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 131 FHVGIYLMY-ENLIFSSTTFIWIKFLGFYGFVILLIWDPCC 12 F V LM+ ++ + +IW+ +L ++ + IW P C Sbjct: 200 FFVPPPLMFLQDFLSHQHAWIWLVWLLSQAWISVHIWSPNC 240 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 131 FHVGIYLMY-ENLIFSSTTFIWIKFLGFYGFVILLIWDPCC 12 F V LM+ ++ + +IW+ +L ++ + IW P C Sbjct: 433 FFVPPPLMFLQDFLSHQHAWIWLVWLLSQAWISVHIWSPNC 473 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 131 FHVGIYLMY-ENLIFSSTTFIWIKFLGFYGFVILLIWDPCC 12 F V LM+ ++ + +IW+ +L ++ + IW P C Sbjct: 433 FFVPPPLMFLQDFLSHQHAWIWLVWLLSQAWISVHIWSPNC 473 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.8 bits (44), Expect = 5.9 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -2 Query: 662 KLLPVLKQMLH*YHHLLVVYWIGMLNIQRRLMRARKTPE*FP*QKFTTITRSLV 501 +L L+QM + + + G L IQR + + F + F +ITR L+ Sbjct: 305 QLFNSLRQMKNNLERIYFYWSFGFLIIQRFIHQIGTLEVAFTGKNFFSITRGLI 358 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 77 FIWIKFLGFYGFVILLIWDPCC 12 +IW+ +L ++ L IW P C Sbjct: 465 WIWLLWLLSQTWITLHIWTPKC 486 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 77 FIWIKFLGFYGFVILLIWDPCC 12 +IW+ +L ++ L IW P C Sbjct: 465 WIWLLWLLSQTWITLHIWTPKC 486 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 77 FIWIKFLGFYGFVILLIWDPCC 12 +IW+ +L ++ L IW P C Sbjct: 465 WIWLLWLLSQTWITLHIWTPKC 486 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 77 FIWIKFLGFYGFVILLIWDPCC 12 +IW+ +L ++ L IW P C Sbjct: 465 WIWLLWLLSQTWITLHIWTPKC 486 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,575 Number of Sequences: 336 Number of extensions: 3552 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -