BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12j14r (363 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC004144-1|AAC27979.1| 1007|Homo sapiens R34001_1 protein. 30 1.9 X89961-1|CAD56487.1| 116|Homo sapiens mitochondrial capsule sel... 29 4.5 X89960-1|CAA62000.1| 116|Homo sapiens mitochondrial capsule sel... 29 4.5 BC016744-1|AAH16744.1| 116|Homo sapiens sperm mitochondria-asso... 29 4.5 BC014593-1|AAH14593.1| 116|Homo sapiens sperm mitochondria-asso... 29 4.5 AL162596-3|CAI19552.1| 116|Homo sapiens sperm mitochondria-asso... 29 4.5 AB076978-1|BAD06454.1| 574|Homo sapiens Grb2-associated binder ... 28 7.8 >AC004144-1|AAC27979.1| 1007|Homo sapiens R34001_1 protein. Length = 1007 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -2 Query: 158 CQPTSLQCCAPLWNCIHCCYIRRC 87 C P Q C P WN C+ R C Sbjct: 965 CTPWPAQTCRPCWNTTRSCWCRPC 988 >X89961-1|CAD56487.1| 116|Homo sapiens mitochondrial capsule selenoprotein protein. Length = 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 158 CQPTSLQCCAPLWNCIHCC 102 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >X89960-1|CAA62000.1| 116|Homo sapiens mitochondrial capsule selenoprotein protein. Length = 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 158 CQPTSLQCCAPLWNCIHCC 102 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >BC016744-1|AAH16744.1| 116|Homo sapiens sperm mitochondria-associated cysteine-rich protein protein. Length = 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 158 CQPTSLQCCAPLWNCIHCC 102 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >BC014593-1|AAH14593.1| 116|Homo sapiens sperm mitochondria-associated cysteine-rich protein protein. Length = 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 158 CQPTSLQCCAPLWNCIHCC 102 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >AL162596-3|CAI19552.1| 116|Homo sapiens sperm mitochondria-associated cysteine-rich protein protein. Length = 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 158 CQPTSLQCCAPLWNCIHCC 102 CQP QCC P N HCC Sbjct: 43 CQPKGSQCCPPKHN--HCC 59 >AB076978-1|BAD06454.1| 574|Homo sapiens Grb2-associated binder 2-like protein protein. Length = 574 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 226 SHFKPPTMDELPVPKGSWQSHHDANQRRFNA 134 SH PPT +P P G +SH A+QR +A Sbjct: 199 SHCVPPTWP-IPAPPGCLRSHQHASQRAEHA 228 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,774,804 Number of Sequences: 237096 Number of extensions: 999539 Number of successful extensions: 2308 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2307 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2248517154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -