BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i17r (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 4.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 4.0 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 4.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.2 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 302 WNCIGIIGSKM*YFYHK*YIDEFICFGCILN 210 WN +G+ G+ + YF Y I G +LN Sbjct: 442 WNVLGVQGALLSYFIEPIYFHS-IVLGSLLN 471 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 493 AWLSLVVVSIVVPTGLLLL 549 A LSLVVV++ + TG LL Sbjct: 60 AMLSLVVVTVAISTGEWLL 78 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 4.0 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = +1 Query: 544 LLGLAPCCWFDV 579 ++G PCCW+ + Sbjct: 482 MIGYYPCCWWKI 493 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 4.0 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = +1 Query: 544 LLGLAPCCWFDV 579 ++G PCCW+ + Sbjct: 535 MIGYYPCCWWKI 546 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 260 KNITSLIQ*YLCSSRLETPLLTFQ 331 + ++S+ Y C R E P+++FQ Sbjct: 644 EEVSSIETNYECGLRFEDPMISFQ 667 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/37 (27%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = -2 Query: 672 PPSASAQFPAGAGRTK---SGSAPKWPGWRCLSYNIK 571 PP + P G+ K +G W + C Y I+ Sbjct: 582 PPESVCSLPCEVGQAKKYVAGEQCCWHCFNCTQYQIR 618 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,772 Number of Sequences: 438 Number of extensions: 4975 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -