BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i08f (581 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IEH5 Cluster: Putative uncharacterized protein MAL13P... 35 1.2 UniRef50_A6H651 Cluster: 1700019O17Rik protein; n=6; Murinae|Rep... 33 3.7 UniRef50_P46764 Cluster: Mitochondrial 60S ribosomal protein L5;... 33 4.9 UniRef50_Q8IB76 Cluster: Putative uncharacterized protein MAL8P1... 33 6.5 >UniRef50_Q8IEH5 Cluster: Putative uncharacterized protein MAL13P1.70; n=5; cellular organisms|Rep: Putative uncharacterized protein MAL13P1.70 - Plasmodium falciparum (isolate 3D7) Length = 3377 Score = 35.1 bits (77), Expect = 1.2 Identities = 15/58 (25%), Positives = 34/58 (58%) Frame = -3 Query: 321 LFTYLLKIKNKNTGYIRKDKNMDFFVTVSI*LKQSYVFFFKSTEFMYLFSHNFFIKTL 148 +F+Y++K+ + YI K+KN D ++ +SI +K + + K ++ F+ ++K + Sbjct: 1691 IFSYIMKLYETYSSYIIKEKNTDLYIFISILIKNVTLSYHK-LKYTNCFNRKKYLKKI 1747 >UniRef50_A6H651 Cluster: 1700019O17Rik protein; n=6; Murinae|Rep: 1700019O17Rik protein - Mus musculus (Mouse) Length = 500 Score = 33.5 bits (73), Expect = 3.7 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = -1 Query: 128 LYIVTSLLRHTRHTFSSGISVNTGYLNTSVSYSVISVETRKL 3 L V SLLR R FSSG+ TG SV++ + SVE R + Sbjct: 433 LRTVASLLRSARSAFSSGVMSGTGSALHSVTHLLESVERRTM 474 >UniRef50_P46764 Cluster: Mitochondrial 60S ribosomal protein L5; n=1; Acanthamoeba castellanii|Rep: Mitochondrial 60S ribosomal protein L5 - Acanthamoeba castellanii (Amoeba) Length = 177 Score = 33.1 bits (72), Expect = 4.9 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -3 Query: 300 IKNKNTGYIRKDKNMDFFVTVSI*LKQSYVFFFKSTEFMYLFSHNFFIKTL 148 IK YI+K FF++VS+ K S+ FF F F H ++ K L Sbjct: 67 IKKVKFSYIKKKILKRFFISVSLNKKNSFNFFMYMLNFYNYFFHIYYQKCL 117 >UniRef50_Q8IB76 Cluster: Putative uncharacterized protein MAL8P1.34; n=3; Plasmodium|Rep: Putative uncharacterized protein MAL8P1.34 - Plasmodium falciparum (isolate 3D7) Length = 1165 Score = 32.7 bits (71), Expect = 6.5 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 548 MNYVKNYKFQCLTAFFCWTMSCMMSR*LYLSKSNH-YIFVFMYIFVF 411 M+ K+YK+ + FF MSC+ +Y+ + YI++F+Y+F++ Sbjct: 1 MSSAKSYKWVIIIFFFFKFMSCVNISDIYIYIYIYIYIYIFIYLFIY 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,083,422 Number of Sequences: 1657284 Number of extensions: 9063904 Number of successful extensions: 23065 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23040 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 40404161459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -