BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i04r (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77850.1 68414.m09072 transcriptional factor B3 family protei... 31 0.66 At1g30450.3 68414.m03722 cation-chloride cotransporter, putative... 28 4.7 At1g30450.2 68414.m03721 cation-chloride cotransporter, putative... 28 4.7 At1g30450.1 68414.m03720 cation-chloride cotransporter, putative... 28 4.7 At4g21050.1 68417.m03044 Dof-type zinc finger domain-containing ... 27 8.2 >At1g77850.1 68414.m09072 transcriptional factor B3 family protein similar to auxin response factor 10 GI:6165644 from [Arabidopsis thaliana]; contains Pfam profile PF02362: B3 DNA binding domain Length = 585 Score = 31.1 bits (67), Expect = 0.66 Identities = 20/57 (35%), Positives = 25/57 (43%) Frame = +1 Query: 103 KSITITNIFYILLGRFDNKFQQNYKNGSRSVITKSGLTNKNGGFFIDVTNFCTESIF 273 + T TN Y GRFD N K + + I N GGF V FC +S+F Sbjct: 93 QQFTPTN--YSRFGRFDGDVDDNNKVTTFAKILTPSDANNGGGF--SVPRFCADSVF 145 >At1g30450.3 68414.m03722 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 294 KINIIVLKYRFRTKIRNVNEKAAIFIGQTRFCYNASTAIFIV 169 K NI+V++Y + N+ E + F+G C A+ A+ I+ Sbjct: 726 KPNIVVMRYPEIWRRENLTEIPSTFVGIINDCITANKAVVII 767 >At1g30450.2 68414.m03721 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 294 KINIIVLKYRFRTKIRNVNEKAAIFIGQTRFCYNASTAIFIV 169 K NI+V++Y + N+ E + F+G C A+ A+ I+ Sbjct: 726 KPNIVVMRYPEIWRRENLTEIPSTFVGIINDCITANKAVVII 767 >At1g30450.1 68414.m03720 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 294 KINIIVLKYRFRTKIRNVNEKAAIFIGQTRFCYNASTAIFIV 169 K NI+V++Y + N+ E + F+G C A+ A+ I+ Sbjct: 726 KPNIVVMRYPEIWRRENLTEIPSTFVGIINDCITANKAVVII 767 >At4g21050.1 68417.m03044 Dof-type zinc finger domain-containing protein PBF protein, Triticum aestivum, EMBL:AJ012284 Length = 210 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 151 DNKFQQNYKN-GSRSVITKSGLTNKNGGFFIDVTNFCTESI 270 D FQQ Y + GS +I + GG+ ++T++C + Sbjct: 158 DESFQQGYYDVGSNDLIDNPLINQSIGGYVDNLTSYCINQV 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,669,780 Number of Sequences: 28952 Number of extensions: 208980 Number of successful extensions: 384 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -