BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i03r (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 25 0.50 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 25 0.50 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 4.6 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 25.4 bits (53), Expect = 0.50 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 584 EELTRTCSIYNITIDRIGNLFL*CM*SFVFFLPKVFIFKF 465 E TCS +T D +F+ C+ + + +P +FI F Sbjct: 200 EGFLTTCSFDFLTDDEDTKVFVTCIFIWAYVIPLIFIILF 239 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 25.4 bits (53), Expect = 0.50 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 584 EELTRTCSIYNITIDRIGNLFL*CM*SFVFFLPKVFIFKF 465 E TCS +T D +F+ C+ + + +P +FI F Sbjct: 200 EGFLTTCSFDFLTDDEDTKVFVTCIFIWAYVIPLIFIILF 239 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 98 FLNSI*YNFIDGYQRQLRC 42 FLNS +FID Q+ L+C Sbjct: 127 FLNSESKDFIDFIQKNLQC 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,829 Number of Sequences: 438 Number of extensions: 3919 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -