BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12i03f (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 26 1.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 26 1.1 AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 pr... 25 1.4 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 1.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 25 1.9 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 17 GDLRRKHHSPHRRVWREGRLPEDRILWSDRNR 112 GD+ H S H +W +G L + ++ S+ +R Sbjct: 1597 GDMVVFHSSKHFSIWIDGHLKVENLITSNESR 1628 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 17 GDLRRKHHSPHRRVWREGRLPEDRILWSDRNR 112 GD+ H S H +W +G L + ++ S+ +R Sbjct: 1598 GDMVVFHSSKHFSIWIDGHLKVENLITSNESR 1629 >AY745213-1|AAU93480.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 223 NEGLHTLQEEITDSIYSYIVDGTGT 149 N+G EEITD IY+ I G T Sbjct: 33 NDGKPFTHEEITDHIYTMIAAGNET 57 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.4 bits (53), Expect = 1.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 273 DQHNFVTIINNNKKLYQKC 329 D+H FV INN K Y+ C Sbjct: 39 DKHYFVLPINNKDKWYRTC 57 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 62 REGRLPEDRILWSDRNRIRAHVPREEELTRTCSI 163 RE PE R + RIR H+P+++E+ + Sbjct: 1103 RESAHPERREQVRPQRRIRQHMPQQKEVVELSDV 1136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 577,554 Number of Sequences: 2352 Number of extensions: 11396 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -