BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l14r (748 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F33580 Cluster: UPI0000F33580 related cluster; n... 36 1.1 UniRef50_Q970J8 Cluster: Putative uncharacterized protein ST1597... 34 4.3 UniRef50_Q02VY2 Cluster: Transcriptional regulator; n=1; Lactoco... 33 5.6 UniRef50_A2TYI2 Cluster: Putative outer membrane protein probabl... 33 9.9 >UniRef50_UPI0000F33580 Cluster: UPI0000F33580 related cluster; n=1; Bos taurus|Rep: UPI0000F33580 UniRef100 entry - Bos Taurus Length = 269 Score = 35.9 bits (79), Expect = 1.1 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +1 Query: 103 VVIEPIS*LLGTLIKLHFVLQIVQHTFYSQFLNSILINTYPTIYKTTLL 249 +++ P + LL + I+ F+L + H+++S FLN IL+ T +T +L Sbjct: 151 LLLFPFARLLSSFIEFFFILLVFLHSYFSWFLNYILLITLEKFSRTKML 199 >UniRef50_Q970J8 Cluster: Putative uncharacterized protein ST1597; n=1; Sulfolobus tokodaii|Rep: Putative uncharacterized protein ST1597 - Sulfolobus tokodaii Length = 376 Score = 33.9 bits (74), Expect = 4.3 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +1 Query: 151 HFVLQIVQHTFYSQFLNSILINTYPTIYKTTLL*SMKFIYIDKRDHRK 294 +FV I H YS++++ + +NT+P I+ T++ S Y+ R+ K Sbjct: 265 YFVHLIFVHVTYSEYISPLTLNTFPLIFMPTVIFSTLADYLRGRELNK 312 >UniRef50_Q02VY2 Cluster: Transcriptional regulator; n=1; Lactococcus lactis subsp. cremoris SK11|Rep: Transcriptional regulator - Lactococcus lactis subsp. cremoris (strain SK11) Length = 201 Score = 33.5 bits (73), Expect = 5.6 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 133 GTLIKLHFVLQIVQHTFYSQFLNSILINTYPTIYKTTLL 249 GT + VL V+H F+SQ L IL ++ T YK +L Sbjct: 57 GTTKNIGVVLSYVKHPFFSQILEEILDKSFETGYKIVIL 95 >UniRef50_A2TYI2 Cluster: Putative outer membrane protein probably involved in nutrient binding; n=1; Polaribacter dokdonensis MED152|Rep: Putative outer membrane protein probably involved in nutrient binding - Polaribacter dokdonensis MED152 Length = 1042 Score = 32.7 bits (71), Expect = 9.9 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 3/94 (3%) Frame = -2 Query: 528 ISNLLLF--YILSATTTTSQKGSFIMNSF*ILNTVYSTDNNVSYFNKMPSNQ*LKTSTVI 355 ISN LL Y+ + T + GSF MN + NT+ + D Y + + L + Sbjct: 423 ISNSLLANNYLKADGTPNNWAGSFTMNPYYATNTLLNEDETNRYIGLISLDIDLLEGLKL 482 Query: 354 N-EVVDKLEYARAFIQRFPATFSVISFINVDKFH 256 N L + AFI R F + +D+F+ Sbjct: 483 NARASQDLSFTNAFIYREKGAFDIAPNGKLDEFN 516 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 626,862,205 Number of Sequences: 1657284 Number of extensions: 11302380 Number of successful extensions: 24045 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24031 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61323318355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -